Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTN1IFTK)

• DOT Name: Complement C1q tumor necrosis factor-related protein 7 (C1QTNF7)
• Gene Name: C1QTNF7
• Related Disease:
  Obesity
  Type-1/2 diabetes
  Conduct disorder
• UniProt ID: C1QT7_HUMAN
• Pfam ID: PF00386 ; PF01391
• Sequence:
  MFVLLYVTSFAICASGQPRGNQLKGENYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGL
  PGRDGRDGRKGEKGEKGTAGLRGKTGPLGLAGEKGDQGETGKKGPIGPEGEKGEVGPIGP
  PGPKGDRGEQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNP
  ATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIKTFDANTGNHDVASGSTVIYLQ
  PEDEVWLEIFFTDQNGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Obesity	DIS47Y1K	Strong	Biomarker	[1]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[1]
Conduct disorder	DISOLUZ1	Limited	Genetic Variation	[2]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Complement C1q tumor necrosis factor-related protein 7 (C1QTNF7).	[3]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Complement C1q tumor necrosis factor-related protein 7 (C1QTNF7).	[6]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Complement C1q tumor necrosis factor-related protein 7 (C1QTNF7).	[7]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the methylation of Complement C1q tumor necrosis factor-related protein 7 (C1QTNF7).	[4]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Complement C1q tumor necrosis factor-related protein 7 (C1QTNF7).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Complement C1q tumor necrosis factor-related protein 7 (C1QTNF7).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the methylation of Complement C1q tumor necrosis factor-related protein 7 (C1QTNF7).	[9]

References

• [1] CTRP7 deletion attenuates obesity-linked glucose intolerance, adipose tissue inflammation, and hepatic stress.Am J Physiol Endocrinol Metab. 2017 Apr 1;312(4):E309-E325. doi: 10.1152/ajpendo.00344.2016. Epub 2017 Feb 21.
• [2] Genome-wide association study of conduct disorder symptomatology.Mol Psychiatry. 2011 Aug;16(8):800-8. doi: 10.1038/mp.2010.73. Epub 2010 Jun 29.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [5] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [6] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [7] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.