Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTO2WDPX)

DOT Name	Interferon kappa (IFNK)
Synonyms	IFN-kappa
Gene Name	IFNK
Related Disease	Barrett esophagus ( ) Common variable immunodeficiency ( ) Cutaneous lupus erythematosus ( ) Leukoencephalopathy with vanishing white matter ( ) Lupus ( ) Systemic lupus erythematosus ( )
UniProt ID	IFNK_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00143
Sequence	MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECL RENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQ QAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSD CAWEIVRVEIRRCLYYFYKFTALFRRK
Function	May play a role in the regulation of immune cell function. Cytokine that imparts cellular protection against viral infection in a species-specific manner. Activates the interferon-stimulated response element signaling pathway. It is able to directly modulate cytokine release from monocytes and dendritic cells. Binds heparin.
Tissue Specificity	Expressed in keratinocytes, monocytes and in resting dendritic cells.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) RIG-I-like receptor sig.ling pathway (hsa04622 ) JAK-STAT sig.ling pathway (hsa04630 )

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Barrett esophagus	DIS416Y7	Strong	Biomarker	[1]
Common variable immunodeficiency	DISHE7JQ	Strong	Genetic Variation	[2]
Cutaneous lupus erythematosus	DISOIX6L	Strong	Biomarker	[3]
Leukoencephalopathy with vanishing white matter	DIS3J8NN	Strong	Biomarker	[1]
Lupus	DISOKJWA	Strong	Biomarker	[3]
Systemic lupus erythematosus	DISI1SZ7	Limited	Altered Expression	[1]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Disease(s)

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Interferon kappa (IFNK).	[4]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Interferon kappa (IFNK).	[5]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Interferon kappa (IFNK).	[6]
------------------------------------------------------------------------------------

References

1	Photosensitivity and type I IFN responses in cutaneous lupus are driven by epidermal-derived interferon kappa.Ann Rheum Dis. 2018 Nov;77(11):1653-1664. doi: 10.1136/annrheumdis-2018-213197. Epub 2018 Jul 18.
2	Limited role of interferon-kappa (IFNK) truncating mutations in common variable immunodeficiency.Cytokine. 2017 Aug;96:71-74. doi: 10.1016/j.cyto.2017.03.005. Epub 2017 Mar 19.
3	Lupus Skin Is Primed for IL-6 Inflammatory Responses through a Keratinocyte-Mediated Autocrine TypeIInterferon Loop.J Invest Dermatol. 2017 Jan;137(1):115-122. doi: 10.1016/j.jid.2016.09.008. Epub 2016 Sep 16.
4	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5	Curcumin restores corticosteroid function in monocytes exposed to oxidants by maintaining HDAC2. Am J Respir Cell Mol Biol. 2008 Sep;39(3):312-23. doi: 10.1165/rcmb.2008-0012OC. Epub 2008 Apr 17.
6	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.