Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOAH2RR)

DOT Name KAT8 regulatory NSL complex subunit 1-like protein (KANSL1L)
Synonyms MSL1v2
Gene Name KANSL1L
Related Disease
Advanced cancer ( )
UniProt ID
KAL1L_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15275
Sequence
MTPALREATAKGISFSSLPSTMESDKMLYMESPRTVDEKLKGDTFSQMLGFPTPEPTLNT
NFVNLKHFGSPQSSKHYQTVFLMRSNSTLNKHNENYKQKKLGEPSCNKLKNILYNGSNIQ
LSKICLSHSEEFIKKEPLSDTTSQCMKDVQIILDSNITKDTNVDKVQLQNCKWYQENALL
DKVTDAEIKKGLLHCTQKKIVPGHSNVPVSSSAAEKEEEVHARLLHCVSKQKILLSQARR
TQKHLQMLLAKHVVKHYGQQMKLSMKHQLPKMKTFHEPTTILGNSLPKCTEIKPEVNTLT
AENKLWDDAKNGFARCTAAEIQRFAFSATGLLSHVEEGLDSDATDSSSDDDLDEYTLRKN
VAVNCSTEWKWLVDRARVGSRWTWLQAQISDLECKIQQLTDIHRQIRASKGIVVLEECQL
PKDILKKQMQFADQAASLNILGNPQVPQECQDPVPEQDFEMSPSSPTLLLRNIEKQSAQL
TEIINSLIAPLNLSPTSSPLSSKSCSHKCLANGIYRSASENLDELSSSSSWLLNQKHSKK
KRKDRTRLKSSSLTFMSTSARTRPLQSFHKRKLYRLSPTFYWTPQTLPSKETAFLNTTQM
PCLQSASTWSSYEHNSESYLLREHVSELDSSFHSVLSLPSDVPLHFHFETLLKKTEIKGN
LAENKFVDEYIISPSPVHSTLNQWRNGYSPICKPQIRSESSAQLLQGRKKRHLSETALGE
RTKLEESDFQHTESGSHSNFTAVSNVNVLSRIQNSSRNTARRRLRSESSYDIDNIVIPMS
LVAPAKLEKLQYKEILTPSWRMVVLQPLDEYNLGKEEIEDLSDEVFSLRHKKYEEREQAR
WSLWEQSKWHRRNSRAYSKNVEGQDLLLKEYPNNFSSSQQCAAASPPGLPSENQDLCAYG
LPSLNQSQETKSLWWERRAFPLKGEDMAALLCQDEKKDQVERSSTAFHGEIFGTSVPENG
HHPKKQSDGMEEYKTFGLGLTNVKKNR

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of KAT8 regulatory NSL complex subunit 1-like protein (KANSL1L). [2]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of KAT8 regulatory NSL complex subunit 1-like protein (KANSL1L). [7]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of KAT8 regulatory NSL complex subunit 1-like protein (KANSL1L). [10]
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of KAT8 regulatory NSL complex subunit 1-like protein (KANSL1L). [11]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of KAT8 regulatory NSL complex subunit 1-like protein (KANSL1L). [13]
------------------------------------------------------------------------------------
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of KAT8 regulatory NSL complex subunit 1-like protein (KANSL1L). [3]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of KAT8 regulatory NSL complex subunit 1-like protein (KANSL1L). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of KAT8 regulatory NSL complex subunit 1-like protein (KANSL1L). [5]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of KAT8 regulatory NSL complex subunit 1-like protein (KANSL1L). [6]
Progesterone DMUY35B Approved Progesterone increases the expression of KAT8 regulatory NSL complex subunit 1-like protein (KANSL1L). [8]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of KAT8 regulatory NSL complex subunit 1-like protein (KANSL1L). [9]
Belinostat DM6OC53 Phase 2 Belinostat decreases the expression of KAT8 regulatory NSL complex subunit 1-like protein (KANSL1L). [9]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of KAT8 regulatory NSL complex subunit 1-like protein (KANSL1L). [12]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of KAT8 regulatory NSL complex subunit 1-like protein (KANSL1L). [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 Risk of ovarian cancer and inherited variants in relapse-associated genes.PLoS One. 2010 Jan 27;5(1):e8884. doi: 10.1371/journal.pone.0008884.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Epidermal growth factor receptor signalling in human breast cancer cells operates parallel to estrogen receptor alpha signalling and results in tamoxifen insensitive proliferation. BMC Cancer. 2014 Apr 23;14:283.
7 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
8 Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
9 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
12 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
13 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
14 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.