Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOLRJLH)

DOT Name Centrosomal protein of 104 kDa (CEP104)
Synonyms Cep104
Gene Name CEP104
Related Disease
Joubert syndrome 17 ( )
Ciliopathy ( )
Joubert syndrome 1 ( )
Joubert syndrome 25 ( )
Joubert syndrome ( )
Neoplasm ( )
UniProt ID
CE104_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
5LPH; 5LPI
Pfam ID
PF21040 ; PF21038 ; PF21039
Sequence
MPHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPRFCQFPQEIVLQMVERCRIRKLQ
LLAHQYMISSKIEFYISESLPEYFAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDA
VGQFLKLIFHQNHVNKYNIYNQVALVAINIIGDPADFSDESNTASREKLIDHYLGHNSED
PALEGTYARKSDYISPLDDLAFDMYQDPEVAQIIRKLDERKREAVQKERYDYAKKLKQAI
ADLQKVGERLGRYEVEKRCAVEKEDYDLAKEKKQQMEQYRAEVYEQLELHSLLDAELMRR
PFDLPLQPLARSGSPCHQKPMPSLPQLEERGTENQFAEPFLQEKPSSYSLTISPQHSAVD
PLLPATDPHPKINAESLPYDERPLPAIRKHYGEAVVEPEMSNADISDARRGGMLGEPEPL
TEKALREASSAIDVLGETLVAEAYCKTWSYREDALLALSKKLMEMPVGTPKEDLKNTLRA
SVFLVRRAIKDIVTSVFQASLKLLKMIITQYIPKHKLSKLETAHCVERTIPVLLTRTGDS
SARLRVTAANFIQEMALFKEVKSLQIIPSYLVQPLKANSSVHLAMSQMGLLARLLKDLGT
GSSGFTIDNVMKFSVSALEHRVYEVRETAVRIILDMYRQHQASILEYLPPDDSNTRRNIL
YKTIFEGFAKIDGRATDAEMRARRKAATEEAEKQKKEEIKALQGQLAALKEIQAEVQEKE
SDAVKPKNQDIQGGKAAPAEALGIPDEHYLDNLCIFCGERSESFTEEGLDLHYWKHCLML
TRCDHCKQVVEISSLTEHLLTECDKKDGFGKCYRCSEAVFKEELPRHIKHKDCNPAKPEK
LANRCPLCHENFSPGEEAWKAHLMGPAGCTMNLRKTHILQKAPALQPGKSSAVAASGPLG
SKAGSKIPTPKGGLSKSSSRTYAKR
Function Required for ciliogenesis and for structural integrity at the ciliary tip.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Joubert syndrome 17 DIS9LHZ1 Definitive Autosomal recessive [1]
Ciliopathy DIS10G4I Strong Genetic Variation [2]
Joubert syndrome 1 DISC9Q82 Strong GermlineCausalMutation [1]
Joubert syndrome 25 DISBSPIN Strong Autosomal recessive [1]
Joubert syndrome DIS7P5CO Supportive Autosomal recessive [1]
Neoplasm DISZKGEW Limited Biomarker [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Centrosomal protein of 104 kDa (CEP104). [4]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Centrosomal protein of 104 kDa (CEP104). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Centrosomal protein of 104 kDa (CEP104). [14]
------------------------------------------------------------------------------------
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Centrosomal protein of 104 kDa (CEP104). [5]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Centrosomal protein of 104 kDa (CEP104). [6]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Centrosomal protein of 104 kDa (CEP104). [7]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Centrosomal protein of 104 kDa (CEP104). [9]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Centrosomal protein of 104 kDa (CEP104). [10]
Folic acid DMEMBJC Approved Folic acid decreases the expression of Centrosomal protein of 104 kDa (CEP104). [11]
Testosterone enanthate DMB6871 Approved Testosterone enanthate affects the expression of Centrosomal protein of 104 kDa (CEP104). [12]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Centrosomal protein of 104 kDa (CEP104). [13]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Centrosomal protein of 104 kDa (CEP104). [15]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Centrosomal protein of 104 kDa (CEP104). [16]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Centrosomal protein of 104 kDa (CEP104). [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)

References

1 Joubert Syndrome in French Canadians and Identification of Mutations in CEP104. Am J Hum Genet. 2015 Nov 5;97(5):744-53. doi: 10.1016/j.ajhg.2015.09.009. Epub 2015 Oct 17.
2 A CEP104-CSPP1 Complex Is Required for Formation of Primary Cilia Competent in Hedgehog Signaling.Cell Rep. 2019 Aug 13;28(7):1907-1922.e6. doi: 10.1016/j.celrep.2019.07.025.
3 The Ciliopathy-Associated Cep104 Protein Interacts with Tubulin and Nek1 Kinase.Structure. 2017 Jan 3;25(1):146-156. doi: 10.1016/j.str.2016.11.014. Epub 2016 Dec 22.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
6 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
9 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
10 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
11 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
12 Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
13 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
14 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
15 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
16 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
17 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.