Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPE3H8B)

• DOT Name: Coiled-coil domain-containing protein 181 (CCDC181)
• Gene Name: CCDC181
• Related Disease:
  Breast cancer
  Breast carcinoma
  Venous thromboembolism
  Prostate cancer
  Prostate carcinoma
• UniProt ID: CC181_HUMAN
• Sequence:
  MNENKDTDSKKSEEYEDDFEKDLEWLINENEKSDASIIEMACEKEENINQDLKENETVME
  HTKRHSDPDKSLQDEVSPRRNDIISVPGIQPLDPISDSDSENSFQESKLESQKDLEEEED
  EEVRRYIMEKIVQANKLLQNQEPVNDKRERKLKFKDQLVDLEVPPLEDTTTFKNYFENER
  NMFGKLSQLCISNDFGQEDVLLSLTNGSCEENKDRTILVERDGKFELLNLQDIASQGFLP
  PINNANSTENDPQQLLPRSSNSSVSGTKKEDSTAKIHAVTHSSTGEPLAYIAQPPLNRKT
  CPSSAVNSDRSKGNGKSNHRTQSAHISPVTSTYCLSPRQKELQKQLEEKREKLKREEERR
  KIEEEKEKKRENDIVFKAWLQKKREQVLEMRRIQRAKEIEDMNSRQENRDPQQAFRLWLK
  KKHEEQMKERQTEELRKQEECLFFLKGTEGRERAFKQWLRRKRMEKMAEQQAVRERTRQL
  RLEAKRSKQLQHHLYMSEAKPFRFTDHYN
• Function: Microtubule-binding protein that localizes to the microtubular manchette of elongating spermatids.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Biomarker	[1]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[1]
Venous thromboembolism	DISUR7CR	Strong	Genetic Variation	[2]
Prostate cancer	DISF190Y	moderate	Biomarker	[3]
Prostate carcinoma	DISMJPLE	moderate	Biomarker	[3]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Coiled-coil domain-containing protein 181 (CCDC181).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Coiled-coil domain-containing protein 181 (CCDC181).	[7]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Coiled-coil domain-containing protein 181 (CCDC181).	[5]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Coiled-coil domain-containing protein 181 (CCDC181).	[6]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 decreases the expression of Coiled-coil domain-containing protein 181 (CCDC181).	[8]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Coiled-coil domain-containing protein 181 (CCDC181).	[9]

References

• [1] DNA methylation marker to estimate the breast cancer cell fraction in DNA samples.Med Oncol. 2018 Sep 14;35(11):147. doi: 10.1007/s12032-018-1207-3.
• [2] A genome-wide association study of venous thromboembolism identifies risk variants in chromosomes 1q24.2 and 9q.J Thromb Haemost. 2012 Aug;10(8):1521-31. doi: 10.1111/j.1538-7836.2012.04810.x.
• [3] Biomarker potential of ST6GALNAC3 and ZNF660 promoter hypermethylation in prostate cancer tissue and liquid biopsies.Mol Oncol. 2018 Apr;12(4):545-560. doi: 10.1002/1878-0261.12183. Epub 2018 Mar 13.
• [4] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [9] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.