Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPNBHZS)

DOT Name Ankyrin repeat and death domain-containing protein 1A (ANKDD1A)
Gene Name ANKDD1A
Related Disease
Glioblastoma multiforme ( )
Neoplasm ( )
UniProt ID
AKD1A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00023 ; PF12796
Sequence
MQEELAWETDGLLPLERQLHEAARQNNVGRMQELIGRRVNTRARNHVGRVALHWAAGAGH
EQAVRLLLEHEAAVDEEDAVGALTEARLCFGMNALLLSAWFGHLRILQILVNSGAKIHCE
SKDGLTLLHCAAQKGHVPVLAFIMEDLEDVALDHVDKLGRTAFHRAAEHGQLDALDFLVG
SGCDHNVKDKEGNTALHLAAGRGHMAVLQRLVDIGLDLEEQNAEGLTALHSAAGGSHPDC
VQLLLRAGSTVNALTQKNLSCLHYAALSGSEDVSRVLIHAGGCANVVDHQGASPLHLAVR
HNFPALVRLLINSDSDVNAVDNRQQTPLHLAAEHAWQDIADMLLIAGVDLNLRDKQGKTA
LAVAVRSNHVSLVDMIIKADRFYRWEKDHPSDPSGKSLSFKQDHRQETQQLRSVLWRLAS
RYLQPREWKKLAYSWEFTEAHVDAIEQQWTGTRSYQEHGHRMLLIWLHGVATAGENPSKA
LFEGLVAIGRRDLAGWSTMARSQLTATSASRVQMILVPQPPE

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Glioblastoma multiforme DISK8246 Definitive Biomarker [1]
Neoplasm DISZKGEW Definitive Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Ankyrin repeat and death domain-containing protein 1A (ANKDD1A). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Ankyrin repeat and death domain-containing protein 1A (ANKDD1A). [9]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Ankyrin repeat and death domain-containing protein 1A (ANKDD1A). [11]
------------------------------------------------------------------------------------
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Ankyrin repeat and death domain-containing protein 1A (ANKDD1A). [3]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of Ankyrin repeat and death domain-containing protein 1A (ANKDD1A). [4]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Ankyrin repeat and death domain-containing protein 1A (ANKDD1A). [5]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Ankyrin repeat and death domain-containing protein 1A (ANKDD1A). [4]
Demecolcine DMCZQGK Approved Demecolcine decreases the expression of Ankyrin repeat and death domain-containing protein 1A (ANKDD1A). [6]
Hydroquinone DM6AVR4 Approved Hydroquinone decreases the expression of Ankyrin repeat and death domain-containing protein 1A (ANKDD1A). [7]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Ankyrin repeat and death domain-containing protein 1A (ANKDD1A). [8]
PMID28870136-Compound-48 DMPIM9L Patented PMID28870136-Compound-48 increases the expression of Ankyrin repeat and death domain-containing protein 1A (ANKDD1A). [10]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Ankyrin repeat and death domain-containing protein 1A (ANKDD1A). [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 Hypermethylated gene ANKDD1A is a candidate tumor suppressor that interacts with FIH1 and decreases HIF1 stability to inhibit cell autophagy in the glioblastoma multiforme hypoxia microenvironment.Oncogene. 2019 Jan;38(1):103-119. doi: 10.1038/s41388-018-0423-9. Epub 2018 Aug 6.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
5 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
6 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
7 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
8 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
9 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
10 Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
11 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
12 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.