Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTR9DOYG)

DOT Name	Gastrokine-2 (GKN2)
Synonyms	Blottin; Down-regulated in gastric cancer; Trefoil factor interactions(z) 1
Gene Name	GKN2
Related Disease	Gastric cancer ( ) Advanced cancer ( ) Lung adenocarcinoma ( ) Neoplasm ( ) Precancerous condition ( ) Prostate cancer ( ) Prostate carcinoma ( ) MALT lymphoma ( ) Adenocarcinoma ( )
UniProt ID	GKN2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF04089
Sequence	MKILVAFLVVLTIFGIQSHGYEVFNIISPSNNGGNVQETVTIDNEKNTAIINIHAGSCSS TTIFDYKHGYIASRVLSRRACFILKMDHQNIPPLNNLQWYIYEKQALDNMFSSKYTWVKY NPLESLIKDVDWFLLGSPIEKLCKHIPLYKGEVVENTHNVGAGGCAKAGLLGILGISICA DIHV
Tissue Specificity	Expressed in gastric mucosa.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Gastric cancer	DISXGOUK	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[2]
Neoplasm	DISZKGEW	Strong	Biomarker	[3]
Precancerous condition	DISV06FL	Strong	Biomarker	[4]
Prostate cancer	DISF190Y	Strong	Biomarker	[5]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[5]
MALT lymphoma	DIS1AVVE	moderate	Genetic Variation	[6]
Adenocarcinoma	DIS3IHTY	Limited	Altered Expression	[7]
------------------------------------------------------------------------------------


⏷ Show the Full List of 9 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Gastrokine-2 (GKN2).	[8]
------------------------------------------------------------------------------------

References

1	GKN2 promotes oxidative stress-induced gastric cancer cell apoptosis via the Hsc70 pathway.J Exp Clin Cancer Res. 2019 Aug 5;38(1):338. doi: 10.1186/s13046-019-1336-3.
2	Methylation and transcriptome analysis reveal lung adenocarcinoma-specific diagnostic biomarkers.J Transl Med. 2019 Sep 27;17(1):324. doi: 10.1186/s12967-019-2068-z.
3	Combination of PET and CXCR4-Targeted Peptide Molecule Agents for Noninvasive Tumor Monitoring.J Cancer. 2019 Jun 9;10(15):3420-3426. doi: 10.7150/jca.31087. eCollection 2019.
4	Loss of gastrokine-2 drives premalignant gastric inflammation and tumor progression.J Clin Invest. 2016 Apr 1;126(4):1383-400. doi: 10.1172/JCI82655. Epub 2016 Mar 14.
5	Phenethyl isothiocyanate inhibits STAT3 activation in prostate cancer cells.Mol Nutr Food Res. 2009 Jul;53(7):878-86. doi: 10.1002/mnfr.200800253.
6	Specificity of polymerase chain reaction monoclonality for diagnosis of gastric mucosa-associated lymphoid tissue (MALT) lymphoma: direct comparison to Southern blot gene rearrangement.Dig Dis Sci. 1998 Feb;43(2):290-9. doi: 10.1023/a:1018842002926.
7	Decreased expression of gastrokine 1 and the trefoil factor interacting protein TFIZ1/GKN2 in gastric cancer: influence of tumor histology and relationship to prognosis.Clin Cancer Res. 2008 Jul 1;14(13):4161-7. doi: 10.1158/1078-0432.CCR-07-4381.
8	Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.