Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTR9TOBV)

DOT Name Chymotrypsinogen B2 (CTRB2)
Synonyms EC 3.4.21.1
Gene Name CTRB2
Related Disease
Pancreatitis ( )
Age-related macular degeneration ( )
Chronic pancreatitis ( )
UniProt ID
CTRB2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.4.21.1
Pfam ID
PF00089
Sequence
MAFLWLLSCWALLGTTFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSRTCST
TTPAVYARVAKLIPWVQKILAAN
KEGG Pathway
Pancreatic secretion (hsa04972 )
Protein digestion and absorption (hsa04974 )
Reactome Pathway
Uptake of dietary cobalamins into enterocytes (R-HSA-9758881 )
Activation of Matrix Metalloproteinases (R-HSA-1592389 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Pancreatitis DIS0IJEF Strong Genetic Variation [1]
Age-related macular degeneration DIS0XS2C moderate Genetic Variation [2]
Chronic pancreatitis DISBUOMJ Limited Genetic Variation [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Chymotrypsinogen B2 (CTRB2). [4]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Chymotrypsinogen B2 (CTRB2). [5]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Chymotrypsinogen B2 (CTRB2). [6]
------------------------------------------------------------------------------------

References

1 Genome-wide association study identifies inversion in the CTRB1-CTRB2 locus to modify risk for alcoholic and non-alcoholic chronic pancreatitis.Gut. 2018 Oct;67(10):1855-1863. doi: 10.1136/gutjnl-2017-314454. Epub 2017 Jul 28.
2 Genome-wide analysis of disease progression in age-related macular degeneration.Hum Mol Genet. 2018 Mar 1;27(5):929-940. doi: 10.1093/hmg/ddy002.
3 Chronic pancreatitis: an update on genetic risk factors.Curr Opin Gastroenterol. 2018 Sep;34(5):322-329. doi: 10.1097/MOG.0000000000000461.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
6 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.