Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRHICBA)

DOT Name	Dolichyldiphosphatase 1 (DOLPP1)
Synonyms	EC 3.6.1.43; Dolichyl pyrophosphate phosphatase 1
Gene Name	DOLPP1
Related Disease	Endometrial cancer ( ) Endometrial carcinoma ( )
UniProt ID	DOPP1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	3.6.1.43
Pfam ID	PF01569
Sequence	MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLIIFKRELHTI SFLGGLALNEGVNWLIKNVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYL RMHQTNNARFLDLLWRHVLSLGLLAVAFLVSYSRVYLLYHTWSQVLYGGIAGGLMAIAWF IFTQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ
Function	Required for efficient N-glycosylation. Necessary for maintaining optimal levels of dolichol-linked oligosaccharides. Hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. Does not act on phosphatidate.
KEGG Pathway	N-Glycan biosynthesis (hsa00510 ) Metabolic pathways (hsa01100 )
Reactome Pathway	Synthesis of Dolichyl-phosphate (R-HSA-446199 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Endometrial cancer	DISW0LMR	Strong	Biomarker	[1]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Dolichyldiphosphatase 1 (DOLPP1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Dolichyldiphosphatase 1 (DOLPP1).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Dolichyldiphosphatase 1 (DOLPP1).	[4]
Selenium	DM25CGV	Approved	Selenium increases the expression of Dolichyldiphosphatase 1 (DOLPP1).	[6]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Dolichyldiphosphatase 1 (DOLPP1).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Dolichyldiphosphatase 1 (DOLPP1).	[7]
------------------------------------------------------------------------------------

References

1	Identification of a potential prognostic lncRNA-miRNA-mRNA signature in endometrial cancer based on the competing endogenous RNA network.J Cell Biochem. 2019 Nov;120(11):18845-18853. doi: 10.1002/jcb.29200. Epub 2019 Jul 24.
2	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3	Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
4	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
6	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
7	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.