Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTS0JN6Y)

DOT Name Homeobox protein orthopedia (OTP)
Gene Name OTP
Related Disease
Anxiety ( )
Anxiety disorder ( )
Attention deficit hyperactivity disorder ( )
Gastric cancer ( )
Neuroendocrine neoplasm ( )
Obesity ( )
Stomach cancer ( )
Advanced cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Carcinoid tumor ( )
Neoplasm ( )
Neuroendocrine cancer ( )
Neuroepithelial neoplasm ( )
Prostate adenocarcinoma ( )
Darier disease ( )
Diastrophic dysplasia ( )
UniProt ID
OTP_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00046 ; PF03826
Sequence
MLSHADLLDARLGMKDAAELLGHREAVKCRLGVGGSDPGGHPGDLAPNSDPVEGATLLPG
EDITTVGSTPASLAVSAKDPDKQPGPQGGPNPSQAGQQQGQQKQKRHRTRFTPAQLNELE
RSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTLLPTPG
LPQFPSAAAAAAAAMGDSLCSFHANDTRWAAAAMPGVSQLPLPPALGRQQAMAQSLSQCS
LAAGPPPNSMGLSNSLAGSNGAGLQSHLYQPAFPGMVPASLPGPSNVSGSPQLCSSPDSS
DVWRGTSIASLRRKALEHTVSMSFT
Function Probably involved in the differentiation of hypothalamic neuroendocrine cells.

Molecular Interaction Atlas (MIA) of This DOT

17 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Anxiety DISIJDBA Strong Biomarker [1]
Anxiety disorder DISBI2BT Strong Biomarker [1]
Attention deficit hyperactivity disorder DISL8MX9 Strong Genetic Variation [1]
Gastric cancer DISXGOUK Strong Biomarker [2]
Neuroendocrine neoplasm DISNPLOO Strong Biomarker [3]
Obesity DIS47Y1K Strong Genetic Variation [1]
Stomach cancer DISKIJSX Strong Biomarker [2]
Advanced cancer DISAT1Z9 moderate Biomarker [4]
Breast cancer DIS7DPX1 moderate Posttranslational Modification [4]
Breast carcinoma DIS2UE88 moderate Posttranslational Modification [4]
Carcinoid tumor DISMNRDC moderate Altered Expression [5]
Neoplasm DISZKGEW moderate Biomarker [5]
Neuroendocrine cancer DISVGJET moderate Altered Expression [5]
Neuroepithelial neoplasm DISCYKLP moderate Altered Expression [5]
Prostate adenocarcinoma DISBZYU8 moderate Altered Expression [5]
Darier disease DIS4WI7S Limited Biomarker [6]
Diastrophic dysplasia DISNTGP7 Limited Biomarker [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Homeobox protein orthopedia (OTP). [7]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Homeobox protein orthopedia (OTP). [9]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Homeobox protein orthopedia (OTP). [8]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Homeobox protein orthopedia (OTP). [8]
------------------------------------------------------------------------------------

References

1 Disruption of the homeodomain transcription factor orthopedia homeobox (Otp) is associated with obesity and anxiety.Mol Metab. 2017 Nov;6(11):1419-1428. doi: 10.1016/j.molmet.2017.08.006. Epub 2017 Aug 24.
2 Oolong tea polyphenol extract induces apoptosis in human stomach cancer cells.Anticancer Res. 2000 Nov-Dec;20(6B):4403-6.
3 Orthopedia Homeobox (OTP) in Pulmonary Neuroendocrine Tumors: The Diagnostic Value and Possible Molecular Interactions.Cancers (Basel). 2019 Oct 8;11(10):1508. doi: 10.3390/cancers11101508.
4 Genome-wide identification of OTP gene as a novel methylation marker of breast cancer.Oncol Rep. 2012 May;27(5):1681-8. doi: 10.3892/or.2012.1691. Epub 2012 Feb 17.
5 Expression of Insulinoma-Associated Protein 1 (INSM1) and Orthopedia Homeobox (OTP) in Tumors with Neuroendocrine Differentiation at Rare Sites.Endocr Pathol. 2019 Mar;30(1):35-42. doi: 10.1007/s12022-018-9559-y.
6 Dynamical decoupling of nitroxides in o-terphenyl: a study of temperature, deuteration and concentration effects.Phys Chem Chem Phys. 2018 Jan 17;20(3):1615-1628. doi: 10.1039/c7cp07074h.
7 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
8 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
9 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.