Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTS3PBOH)

• DOT Name: Ermin (ERMN)
• Synonyms: Juxtanodin; JN
• Gene Name: ERMN
• Related Disease:
  Autism spectrum disorder
  Multiple sclerosis
  Relapsing-remitting multiple sclerosis
  Schizophrenia
• UniProt ID: ERMIN_HUMAN
• Pfam ID: PF20491
• Sequence:
  MTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEE
  RRKLQGNMLLNSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPL
  SGSNQEIRRQKERITEQPLKEEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQK
  VWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDE
  QPTLGKKSDISRNAYSRYNTISYRKIRKGNTKQRIDEFESMMHL
• Function: Plays a role in cytoskeletal rearrangements during the late wrapping and/or compaction phases of myelinogenesis as well as in maintenance and stability of myelin sheath in the adult. May play an important role in late-stage oligodendroglia maturation, myelin/Ranvier node formation during CNS development, and in the maintenance and plasticity of related structures in the mature CNS.
• Tissue Specificity: Highly expressed in adult and fetal brain. Expressed at intermediate levels in the lung and liver.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[1]
Multiple sclerosis	DISB2WZI	Strong	Altered Expression	[2]
Relapsing-remitting multiple sclerosis	DISSXFCF	Strong	Altered Expression	[2]
Schizophrenia	DISSRV2N	Strong	Altered Expression	[3]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Ermin (ERMN).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Ermin (ERMN).	[8]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Ermin (ERMN).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Ermin (ERMN).	[6]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Ermin (ERMN).	[7]

References

• [1] Genetic and epigenetic methylation defects and implication of the ERMN gene in autism spectrum disorders.Transl Psychiatry. 2016 Jul 12;6(7):e855. doi: 10.1038/tp.2016.120.
• [2] Down-regulation of ERMN expression in relapsing remitting multiple sclerosis.Metab Brain Dis. 2019 Oct;34(5):1261-1266. doi: 10.1007/s11011-019-00429-w. Epub 2019 May 23.
• [3] Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.J Neural Transm (Vienna). 2009 Mar;116(3):275-89. doi: 10.1007/s00702-008-0156-y. Epub 2008 Nov 26.
• [4] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [5] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.