Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSFFV9B)

DOT Name	Retinol dehydrogenase 8 (RDH8)
Synonyms	EC 1.1.1.300; Photoreceptor outer segment all-trans retinol dehydrogenase; Short chain dehydrogenase/reductase family 28C member 2
Gene Name	RDH8
Related Disease	Myopia ( ) Age-related macular degeneration ( ) Retinopathy ( ) Stargardt disease ( )
UniProt ID	RDH8_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	1.1.1.300
Pfam ID	PF00106
Sequence	MAAAPRTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLGKKETLEAAAGEALGQTL TVAQLDVCSDESVAQCLSCIQGEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVR LVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFI SLVEPGPVVTEFEGKLLAQVSMAEFPGTDPETLHYFRDLYLPASRKLFCSVGQNPQDVVQ AIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCLS CGCLPTRVRPR
Function	Retinol dehydrogenase with a clear preference for NADP. Converts all-trans-retinal to all-trans-retinol. May play a role in the regeneration of visual pigment at high light intensity.
Tissue Specificity	Detected in photoreceptor outer segments in the retina (at protein level).
KEGG Pathway	Retinol metabolism (hsa00830 ) Metabolic pathways (hsa01100 )
Reactome Pathway	The canonical retinoid cycle in rods (twilight vision) (R-HSA-2453902 )
BioCyc Pathway	MetaCyc:HS01358-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Myopia	DISK5S60	Strong	Genetic Variation	[1]
Age-related macular degeneration	DIS0XS2C	moderate	Biomarker	[2]
Retinopathy	DISB4B0F	moderate	Biomarker	[3]
Stargardt disease	DISPXOTO	moderate	Biomarker	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Retinol dehydrogenase 8 (RDH8).	[4]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Retinol dehydrogenase 8 (RDH8).	[5]
------------------------------------------------------------------------------------

References

1	Investigation of the association between all-trans-retinol dehydrogenase (RDH8) polymorphisms and high myopia in Chinese.J Zhejiang Univ Sci B. 2010 Nov;11(11):836-41. doi: 10.1631/jzus.B1000001.
2	Acute Stress Responses Are Early Molecular Events of Retinal Degeneration in Abca4-/-Rdh8-/- Mice After Light Exposure.Invest Ophthalmol Vis Sci. 2016 Jun 1;57(7):3257-67. doi: 10.1167/iovs.15-18993.
3	Aberrant Buildup of All-Trans-Retinal Dimer, a Nonpyridinium Bisretinoid Lipofuscin Fluorophore, Contributes to the Degeneration of the Retinal Pigment Epithelium.Invest Ophthalmol Vis Sci. 2017 Feb 1;58(2):1063-1075. doi: 10.1167/iovs.16-20734.
4	Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
5	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.