Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSLRFRF)

• DOT Name: Stromal cell-derived factor 2 (SDF2)
• Synonyms: SDF-2
• Gene Name: SDF2
• Related Disease:
  Breast cancer
  Breast carcinoma
  Asthma
• UniProt ID: SDF2_HUMAN
• Pfam ID: PF02815
• Sequence:
  MAVVPLLLLGGLWSAVGASSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGV
  TSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSA
  FGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMA
  QPSQNNYWKAMEGIFMKPSELLKAEAHHAEL

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Altered Expression	[1]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[1]
Asthma	DISW9QNS	Limited	Genetic Variation	[2]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Stromal cell-derived factor 2 (SDF2).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Stromal cell-derived factor 2 (SDF2).	[4]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Stromal cell-derived factor 2 (SDF2).	[5]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Stromal cell-derived factor 2 (SDF2).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Stromal cell-derived factor 2 (SDF2).	[6]

References

• [1] Transcript analyses of stromal cell derived factors (SDFs): SDF-2, SDF-4 and SDF-5 reveal a different pattern of expression and prognostic association in human breast cancer.Int J Oncol. 2009 Jul;35(1):205-11. doi: 10.3892/ijo_00000330.
• [2] The IL9R region contribution in asthma is supported by genetic association in an isolated population.Eur J Hum Genet. 2000 Oct;8(10):788-92. doi: 10.1038/sj.ejhg.5200541.
• [3] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [4] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [5] A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
• [6] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [7] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.