Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTEMYL1)

DOT Name Coiled-coil domain-containing protein 93 (CCDC93)
Gene Name CCDC93
Related Disease
Myocardial infarction ( )
UniProt ID
CCD93_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
8F2U
Pfam ID
PF09762 ; PF21673
Sequence
MGLPRGPEGQGLPEVETREDEEQNVKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWC
ITTCNFDVDVDLLFQENSTIGQKIALSEKIVSVLPRMKCPHQLEPHQIQGMDFIHIFPVV
QWLVKRAIETKEEMGDYIRSYSVSQFQKTYSLPEDDDFIKRKEKAIKTVVDLSEVYKPRR
KYKRHQGAEELLDEESRIHATLLEYGRRYGFSRQSKMEKAEDKKTALPAGLSATEKADAH
EEDELRAAEEQRIQSLMTKMTAMANEESRLTASSVGQIVGLCSAEIKQIVSEYAEKQSEL
SAEESPEKLGTSQLHRRKVISLNKQIAQKTKHLEELRASHTSLQARYNEAKKTLTELKTY
SEKLDKEQAALEKIESKADPSILQNLRALVAMNENLKSQEQEFKAHCREEMTRLQQEIEN
LKAERAPRGDEKTLSSGEPPGTLTSAMTHDEDLDRRYNMEKEKLYKIRLLQARRNREIAI
LHRKIDEVPSRAELIQYQKRFIELYRQISAVHKETKQFFTLYNTLDDKKVYLEKEISLLN
SIHENFSQAMASPAARDQFLRQMEQIVEGIKQSRMKMEKKKQENKMRRDQLNDQYLELLE
KQRLYFKTVKEFKEEGRKNEMLLSKVKAKAS
Function
Component of the CCC complex, which is involved in the regulation of endosomal recycling of surface proteins, including integrins, signaling receptor and channels. The CCC complex associates with SNX17, retriever and WASH complexes to prevent lysosomal degradation and promote cell surface recycling of numerous cargos such as integrins ITGA5:ITGB1. Involved in copper-dependent ATP7A trafficking between the trans-Golgi network and vesicles in the cell periphery; the function is proposed to depend on its association within the CCC complex and cooperation with the WASH complex on early endosomes and is dependent on its interaction with WASHC2C ; (Microbial infection) The CCC complex, in collaboration with the heterotrimeric retriever complex, mediates the exit of human papillomavirus to the cell surface.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Myocardial infarction DIS655KI Strong Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Coiled-coil domain-containing protein 93 (CCDC93). [2]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Coiled-coil domain-containing protein 93 (CCDC93). [3]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Coiled-coil domain-containing protein 93 (CCDC93). [4]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Coiled-coil domain-containing protein 93 (CCDC93). [5]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Coiled-coil domain-containing protein 93 (CCDC93). [6]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Coiled-coil domain-containing protein 93 (CCDC93). [7]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Coiled-coil domain-containing protein 93 (CCDC93). [8]
Tamibarotene DM3G74J Phase 3 Tamibarotene decreases the expression of Coiled-coil domain-containing protein 93 (CCDC93). [4]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Coiled-coil domain-containing protein 93 (CCDC93). [9]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Coiled-coil domain-containing protein 93 (CCDC93). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 A common variant in CCDC93 protects against myocardial infarction and cardiovascular mortality by regulating endosomal trafficking of low-density lipoprotein receptor.Eur Heart J. 2020 Mar 1;41(9):1040-1053. doi: 10.1093/eurheartj/ehz727.
2 Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
5 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
6 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
9 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
10 Epigenetic influences of low-dose bisphenol A in primary human breast epithelial cells. Toxicol Appl Pharmacol. 2010 Oct 15;248(2):111-21.