Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTP8DRJ)

• DOT Name: Fin bud initiation factor homolog (FIBIN)
• Gene Name: FIBIN
• Related Disease: Mental disorder
• UniProt ID: FIBIN_HUMAN
• Pfam ID: PF15819
• Sequence:
  MVFLKFFCMSFFCHLCQGYFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSD
  HRRCSQGEGSQVGSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLR
  RESHQIGDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDIS
  VGLRDKYELLALTIRSHGTRLGRLKNDYLKV

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Mental disorder	DIS3J5R8	Strong	Genetic Variation	[1]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Fin bud initiation factor homolog (FIBIN).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Fin bud initiation factor homolog (FIBIN).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Fin bud initiation factor homolog (FIBIN).	[10]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Fin bud initiation factor homolog (FIBIN).	[3]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Fin bud initiation factor homolog (FIBIN).	[4]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Fin bud initiation factor homolog (FIBIN).	[5]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Fin bud initiation factor homolog (FIBIN).	[6]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Fin bud initiation factor homolog (FIBIN).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Fin bud initiation factor homolog (FIBIN).	[9]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Fin bud initiation factor homolog (FIBIN).	[11]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Fin bud initiation factor homolog (FIBIN).	[12]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Fin bud initiation factor homolog (FIBIN).	[13]

References

• [1] CNV-association meta-analysis in 191,161 European adults reveals new loci associated with anthropometric traits.Nat Commun. 2017 Sep 29;8(1):744. doi: 10.1038/s41467-017-00556-x.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [4] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [5] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [6] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [7] The MT1G Gene in LUHMES Neurons Is a Sensitive Biomarker of Neurotoxicity. Neurotox Res. 2020 Dec;38(4):967-978. doi: 10.1007/s12640-020-00272-3. Epub 2020 Sep 1.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [10] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [11] Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
• [12] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [13] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.