General Information of Drug Off-Target (DOT) (ID: OTTPOIOP)

DOT Name Dehydrogenase/reductase SDR family member 4 (DHRS4)
Synonyms
EC 1.1.1.184; NADPH-dependent carbonyl reductase; CR; NADPH-dependent retinol dehydrogenase/reductase; NRDR; humNRDR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; SCAD-SRL; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; Short-chain dehydrogenase/reductase family member 4
Gene Name DHRS4
Related Disease
Squamous cell carcinoma ( )
Clear cell renal carcinoma ( )
Neoplasm ( )
UniProt ID
DHRS4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3O4R
EC Number
1.1.1.184
Pfam ID
PF13561
Sequence
MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVV
VSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVN
PFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFS
PYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIR
RLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL
Function
NADPH-dependent oxidoreductase which catalyzes the reduction of a variety of compounds bearing carbonyl groups including ketosteroids, alpha-dicarbonyl compounds, aldehydes, aromatic ketones and quinones. Reduces 3-ketosteroids and benzil into 3beta-hydroxysteroids and R-benzoin, respectively, in contrast to the stereoselectivity of non-primate DHRS4s which produce 3alpha-hydroxysteroids and S-benzoin. Diplays low activity toward all-trans-retinal and no activity toward 9-cis-retinal as compared to non-primate mammals. In the reverse reaction, catalyze the NAD-dependent oxidation of 3beta-hydroxysteroids and alcohol, but with much lower efficiency. Involved in the metabolism of 3beta-hydroxysteroids, isatin and xenobiotic carbonyl compounds ; [Isoform 7]: No detected catalytic activity in vitro, possibly due to the lack of catalytic site; [Isoform 8]: NADPH-dependent oxidoreductase which catalyzes the reduction of a variety of compounds bearing carbonyl groups including ketosteroids, alpha-dicarbonyl compounds, aldehydes, aromatic ketones and quinones. Involved in the metabolism of 3beta-hydroxysteroids, isatin and xenobiotic carbonyl compounds. Has a higher catalytic activity for xenobiotic alpha-dicarbonyl compounds, sucha as benzil, than isoform 1 and is involved in benzil detoxification.
Tissue Specificity
.Predominantly expressed in normal cervix (at protein level).; [Isoform 4]: Expressed in some neoplastic cervical tissues, but not in normal cervix (at protein level).; [Isoform 5]: Expressed in a few neoplastic cervical tissues.; [Isoform 6]: Expressed in a few neoplastic cervical tissues.; [Isoform 8]: High expression in liver.
KEGG Pathway
Retinol metabolism (hsa00830 )
Metabolic pathways (hsa01100 )
Peroxisome (hsa04146 )
Reactome Pathway
Peroxisomal protein import (R-HSA-9033241 )
RA biosynthesis pathway (R-HSA-5365859 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Squamous cell carcinoma DISQVIFL Strong Genetic Variation [1]
Clear cell renal carcinoma DISBXRFJ moderate Biomarker [2]
Neoplasm DISZKGEW moderate Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Dehydrogenase/reductase SDR family member 4 (DHRS4). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Dehydrogenase/reductase SDR family member 4 (DHRS4). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Dehydrogenase/reductase SDR family member 4 (DHRS4). [5]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Dehydrogenase/reductase SDR family member 4 (DHRS4). [7]
Selenium DM25CGV Approved Selenium increases the expression of Dehydrogenase/reductase SDR family member 4 (DHRS4). [8]
Testosterone enanthate DMB6871 Approved Testosterone enanthate affects the expression of Dehydrogenase/reductase SDR family member 4 (DHRS4). [9]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of Dehydrogenase/reductase SDR family member 4 (DHRS4). [8]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Dehydrogenase/reductase SDR family member 4 (DHRS4). [10]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Dehydrogenase/reductase SDR family member 4 (DHRS4). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Dehydrogenase/reductase SDR family member 4 (DHRS4). [6]
------------------------------------------------------------------------------------

References

1 Expression of a novel alternatively spliced variant of NADP(H)-dependent retinol dehydrogenase/reductase with deletion of exon 3 in cervical squamous carcinoma.Int J Cancer. 2007 Apr 15;120(8):1618-26. doi: 10.1002/ijc.22306.
2 The downregulated long noncoding RNA DHRS4-AS1 is protumoral and associated with the prognosis of clear cell renal cell carcinoma.Onco Targets Ther. 2018 Sep 10;11:5631-5646. doi: 10.2147/OTT.S164984. eCollection 2018.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
7 Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
8 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
9 Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
10 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
11 Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.