Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTQ468O)

DOT Name	Intestinal-type alkaline phosphatase (ALPI)
Synonyms	IAP; Intestinal alkaline phosphatase; EC 3.1.3.1
Gene Name	ALPI
UniProt ID	PPBI_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	3.1.3.1
Pfam ID	PF00245
Sequence	MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLG DGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLC GVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYA HTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADA SQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRD PTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERA GQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHV MAFAACLEPYTACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP
Function	Alkaline phosphatase that can hydrolyze various phosphate compounds.
KEGG Pathway	Thiamine metabolism (hsa00730 ) Folate biosynthesis (hsa00790 ) Metabolic pathways (hsa01100 ) Biosynthesis of cofactors (hsa01240 )
Reactome Pathway	Post-translational modification (R-HSA-163125 ) Digestion (R-HSA-8935690 ) Synthesis of PA (R-HSA-1483166 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Intestinal-type alkaline phosphatase (ALPI).	[1]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Intestinal-type alkaline phosphatase (ALPI).	[5]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Intestinal-type alkaline phosphatase (ALPI).	[7]
------------------------------------------------------------------------------------

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Intestinal-type alkaline phosphatase (ALPI).	[2]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the activity of Intestinal-type alkaline phosphatase (ALPI).	[3]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Intestinal-type alkaline phosphatase (ALPI).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Intestinal-type alkaline phosphatase (ALPI).	[4]
Wortmannin	DM8EVK5	Terminated	Wortmannin increases the activity of Intestinal-type alkaline phosphatase (ALPI).	[3]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Intestinal-type alkaline phosphatase (ALPI).	[6]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Intestinal-type alkaline phosphatase (ALPI).	[8]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID decreases the expression of Intestinal-type alkaline phosphatase (ALPI).	[9]
Cycloheximide	DMGDA3C	Investigative	Cycloheximide decreases the activity of Intestinal-type alkaline phosphatase (ALPI).	[10]
Microcystin-LR	DMTMLRN	Investigative	Microcystin-LR decreases the expression of Intestinal-type alkaline phosphatase (ALPI).	[11]
PD98059	DMZC90M	Investigative	PD98059 increases the activity of Intestinal-type alkaline phosphatase (ALPI).	[3]
------------------------------------------------------------------------------------


⏷ Show the Full List of 11 Drug(s)

References

1	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2	Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
3	Methotrexate induced differentiation in colon cancer cells is primarily due to purine deprivation. J Cell Biochem. 2006 Sep 1;99(1):146-55. doi: 10.1002/jcb.20908.
4	Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
5	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
6	Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.
7	Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
8	Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
9	Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.
10	Deoxynivalenol affects in vitro intestinal epithelial cell barrier integrity through inhibition of protein synthesis. Toxicol Appl Pharmacol. 2010 Jun 15;245(3):291-8. doi: 10.1016/j.taap.2010.03.012. Epub 2010 Apr 1.
11	Gene expression network regulated by DNA methylation and microRNA during microcystin-leucine arginine induced malignant transformation in human hepatocyte L02 cells. Toxicol Lett. 2018 Jun 1;289:42-53. doi: 10.1016/j.toxlet.2018.03.003. Epub 2018 Mar 5.