Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTSURLA)

• DOT Name: Outer dense fiber protein 1 (ODF1)
• Synonyms: Heat shock protein beta-10; HspB10
• Gene Name: ODF1
• Related Disease:
  Adult lymphoma
  Alzheimer disease
  Bone giant cell tumor
  Lymphoma
  Male infertility
  Neoplasm
  Pediatric lymphoma
  Prostate adenocarcinoma
  Type-1/2 diabetes
  Rheumatoid arthritis
• UniProt ID: ODFP1_HUMAN
• Pfam ID: PF00011
• Sequence:
  MAALSCLLDSVRRDIKKVDRELRQLRCIDEFSTRCLCDLYMHPYCCCDLHPYPYCLCYSK
  RSRSCGLCDLYPCCLCDYKLYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSC
  CSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPC
  VDEKDVTYSYGLGSCVKIESPCYPCTSPCSPCSPCSPCNPCSPCNPCSPYDPCNPCYPCG
  SRFSCRKMIL
• Function: Component of the outer dense fibers (ODF) of spermatozoa. ODF are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail.
• Tissue Specificity: Testis.

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult lymphoma	DISK8IZR	Strong	Altered Expression	[1]
Alzheimer disease	DISF8S70	Strong	Biomarker	[2]
Bone giant cell tumor	DIS0RGK9	Strong	Biomarker	[3]
Lymphoma	DISN6V4S	Strong	Altered Expression	[1]
Male infertility	DISY3YZZ	Strong	Biomarker	[4]
Neoplasm	DISZKGEW	Strong	Biomarker	[5]
Pediatric lymphoma	DIS51BK2	Strong	Altered Expression	[1]
Prostate adenocarcinoma	DISBZYU8	Strong	Altered Expression	[1]
Type-1/2 diabetes	DISIUHAP	moderate	Biomarker	[6]
Rheumatoid arthritis	DISTSB4J	Limited	Altered Expression	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Outer dense fiber protein 1 (ODF1).	[8]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Outer dense fiber protein 1 (ODF1).	[9]

References

• [1] Expression of splice variants of cancer-testis genes ODF3 and ODF4 in the testis of a prostate cancer patient.Genet Mol Res. 2012 Oct 4;11(4):3642-8. doi: 10.4238/2012.October.4.11.
• [2] Chitosan nanofilm and electrospun nanofiber for quick drug release in the treatment of Alzheimer's disease: In vitro and in vivo evaluation.Int J Biol Macromol. 2017 Dec;105(Pt 1):131-142. doi: 10.1016/j.ijbiomac.2017.07.021. Epub 2017 Jul 8.
• [3] Cytological properties of stromal cells derived from giant cell tumor of bone (GCTSC) which can induce osteoclast formation of human blood monocytes without cell to cell contact.J Orthop Res. 2005 Sep;23(5):979-87. doi: 10.1016/j.orthres.2005.01.004.
• [4] CCDC42 Localizes to Manchette, HTCA and Tail and Interacts With ODF1 and ODF2 in the Formation of the Male Germ Cell Cytoskeleton.Front Cell Dev Biol. 2019 Aug 14;7:151. doi: 10.3389/fcell.2019.00151. eCollection 2019.
• [5] Elevated expression levels of testis-specific genes TEX101 and SPATA19 in basal cell carcinoma and their correlation with clinical and pathological features.Br J Dermatol. 2010 Apr;162(4):772-9. doi: 10.1111/j.1365-2133.2009.09568.x. Epub 2009 Nov 3.
• [6] Effect of paternal diabetes on pre-diabetic phenotypes in adult offspring.Diabetes Care. 2010 Aug;33(8):1823-8. doi: 10.2337/dc10-0664. Epub 2010 Jun 2.
• [7] Synovial tissue in rheumatoid arthritis is a source of osteoclast differentiation factor.Arthritis Rheum. 2000 Feb;43(2):250-8. doi: 10.1002/1529-0131(200002)43:2<250::AID-ANR3>3.0.CO;2-P.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.