Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTTPGG2)

DOT Name Prostate and testis expressed protein 1 (PATE1)
Gene Name PATE1
Related Disease
Male infertility ( )
Prostate cancer ( )
Prostate carcinoma ( )
UniProt ID
PATE1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDKSLLLELPILLCCFRALSGSLSMRNDAVNEIVAVKNNFPVIEIVQCRMCHLQFPGEKC
SRGRGICTATTEEACMVGRMFKRDGNPWLTFMGCLKNCADVKGIRWSVYLVNFRCCRSHD
LCNEDL
Tissue Specificity Expressed specifically in prostate cancer, normal prostate, and testis. Expressed in the epithelial cells of the prostate cancer and normal prostate tissues.
KEGG Pathway
Neuroactive ligand-receptor interaction (hsa04080 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Male infertility DISY3YZZ Strong Biomarker [1]
Prostate cancer DISF190Y Strong Altered Expression [2]
Prostate carcinoma DISMJPLE Strong Altered Expression [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Prostate and testis expressed protein 1 (PATE1). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Prostate and testis expressed protein 1 (PATE1). [4]
------------------------------------------------------------------------------------

References

1 Aged men share the sperm protein PATE1 defect with young asthenozoospermia patients.Hum Reprod. 2015 Apr;30(4):861-9. doi: 10.1093/humrep/dev003. Epub 2015 Jan 29.
2 PATE, a gene expressed in prostate cancer, normal prostate, and testis, identified by a functional genomic approach.Proc Natl Acad Sci U S A. 2002 Mar 5;99(5):3058-63. doi: 10.1073/pnas.052713699.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.