Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTZB64A)

DOT Name Lymphocyte antigen 86 (LY86)
Synonyms Ly-86; Protein MD-1
Gene Name LY86
Related Disease
Colitis ( )
Epilepsy, idiopathic generalized ( )
Obesity ( )
Ulcerative colitis ( )
Calcinosis ( )
Familial tumoral calcinosis ( )
Heart valve disorder ( )
Asthma ( )
Venous thromboembolism ( )
UniProt ID
LY86_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3B2D
Pfam ID
PF02221
Sequence
MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSK
QLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQI
YYAGPVNNPEFTIPQGEYQVLLELYTEKRSTVACANATIMCS
Function May cooperate with CD180 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS) and cytokine production. Important for efficient CD180 cell surface expression.
Tissue Specificity Highly expressed in B-cells, monocytes and tonsil.
Reactome Pathway
Toll Like Receptor 4 (TLR4) Cascade (R-HSA-166016 )

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Colitis DISAF7DD Strong Altered Expression [1]
Epilepsy, idiopathic generalized DISODZC9 Strong Genetic Variation [2]
Obesity DIS47Y1K Strong Genetic Variation [3]
Ulcerative colitis DIS8K27O Strong Altered Expression [1]
Calcinosis DISQP4OR moderate Biomarker [4]
Familial tumoral calcinosis DISYJZKG moderate Biomarker [4]
Heart valve disorder DIS84O7T moderate Biomarker [4]
Asthma DISW9QNS Limited Genetic Variation [5]
Venous thromboembolism DISUR7CR Limited Biomarker [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Lymphocyte antigen 86 (LY86). [7]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Lymphocyte antigen 86 (LY86). [10]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Lymphocyte antigen 86 (LY86). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Lymphocyte antigen 86 (LY86). [9]
------------------------------------------------------------------------------------

References

1 Inhibition of myeloid differentiation 1 specifically in colon with antisense oligonucleotide exacerbates dextran sodium sulfate-induced colitis.J Cell Biochem. 2019 Oct;120(10):16888-16899. doi: 10.1002/jcb.28947. Epub 2019 May 19.
2 Single nucleotide polymorphisms and haplotype of MD-1 gene associated with high serum IgE phenotype with mite-sensitive allergy in Taiwanese children.Int J Immunogenet. 2007 Dec;34(6):407-12. doi: 10.1111/j.1744-313X.2007.00711.x.
3 DNA methylation of the LY86 gene is associated with obesity, insulin resistance, and inflammation.Twin Res Hum Genet. 2014 Jun;17(3):183-91. doi: 10.1017/thg.2014.22. Epub 2014 Apr 15.
4 Raloxifene attenuates Gas6 and apoptosis in experimental aortic valve disease in renal failure.Am J Physiol Heart Circ Physiol. 2011 May;300(5):H1829-40. doi: 10.1152/ajpheart.00240.2010. Epub 2011 Feb 18.
5 Association of single nucleotide polymorphisms of MD-1 gene with pediatric and adult asthma in the Taiwanese population.J Microbiol Immunol Infect. 2008 Dec;41(6):445-9.
6 Identification of unique venous thromboembolism-susceptibility variants in African-Americans.Thromb Haemost. 2017 Apr 3;117(4):758-768. doi: 10.1160/TH16-08-0652. Epub 2017 Feb 16.
7 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
8 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
9 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
10 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.