Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU6WP6J)

• DOT Name: Chemokine-like protein TAFA-2 (TAFA2)
• Gene Name: TAFA2
• Related Disease:
  Anorexia nervosa cachexia
  Obsessive compulsive disorder
  Anxiety disorder
  Chronic obstructive pulmonary disease
• UniProt ID: TAFA2_HUMAN
• Pfam ID: PF12020
• Sequence:
  MSKRYLQKATKGKLLIIIFIVTLWGKVVSSANHHKAHHVKTGTCEVVALHRCCNKNKIEE
  RSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSS
  GNKVKTTRVTH
• Function: Has a role as neurotrophic factor involved in neuronal survival and neurobiological functions.
• Tissue Specificity: Brain-specific.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Anorexia nervosa cachexia	DISFO5RQ	Definitive	Genetic Variation	[1]
Obsessive compulsive disorder	DIS1ZMM2	Definitive	Genetic Variation	[1]
Anxiety disorder	DISBI2BT	Strong	Biomarker	[2]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Genetic Variation	[3]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Chemokine-like protein TAFA-2 (TAFA2).	[4]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Chemokine-like protein TAFA-2 (TAFA2).	[5]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Chemokine-like protein TAFA-2 (TAFA2).	[6]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Chemokine-like protein TAFA-2 (TAFA2).	[7]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Chemokine-like protein TAFA-2 (TAFA2).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Chemokine-like protein TAFA-2 (TAFA2).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Chemokine-like protein TAFA-2 (TAFA2).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Chemokine-like protein TAFA-2 (TAFA2).	[10]

References

• [1] Examination of the shared genetic basis of anorexia nervosa and obsessive-compulsive disorder.Mol Psychiatry. 2020 Sep;25(9):2036-2046. doi: 10.1038/s41380-018-0115-4. Epub 2018 Aug 7.
• [2] Targeted knockout of a chemokine-like gene increases anxiety and fear responses.Proc Natl Acad Sci U S A. 2018 Jan 30;115(5):E1041-E1050. doi: 10.1073/pnas.1707663115. Epub 2018 Jan 16.
• [3] A genome-wide association study identifies risk loci for spirometric measures among smokers of European and African ancestry.BMC Genet. 2015 Dec 3;16:138. doi: 10.1186/s12863-015-0299-4.
• [4] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [5] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [6] Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
• [7] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [8] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [10] Expression and DNA methylation changes in human breast epithelial cells after bisphenol A exposure. Int J Oncol. 2012 Jul;41(1):369-77.