Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU7KCQL)

• DOT Name: PI-PLC X domain-containing protein 1 (PLCXD1)
• Gene Name: PLCXD1
• UniProt ID: PLCX1_HUMAN
• Pfam ID: PF00388
• Sequence:
  MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTYCLNKKSPISH
  EESRLLQLLNKALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHF
  VHMVYTTALVEDTLTEISEWLERHPREVVILACRNFEGLSEDLHEYLVACIKNIFGDMLC
  PRGEVPTLRQLWSRGQQVIVSYEDESSLRRHHELWPGVPYWWGNRVKTEALIRYLETMKS
  CGRPGGLFVAGINLTENLQYVLAHPSESLEKMTLPNLPRLSAWVREQCPGPGSRCTNIIA
  GDFIGADGFVSDVIALNQKLLWC
• Tissue Specificity: Widely expressed.

Molecular Interaction Atlas (MIA) of This DOT

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of PI-PLC X domain-containing protein 1 (PLCXD1).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of PI-PLC X domain-containing protein 1 (PLCXD1).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of PI-PLC X domain-containing protein 1 (PLCXD1).	[3]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of PI-PLC X domain-containing protein 1 (PLCXD1).	[4]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of PI-PLC X domain-containing protein 1 (PLCXD1).	[5]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of PI-PLC X domain-containing protein 1 (PLCXD1).	[6]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of PI-PLC X domain-containing protein 1 (PLCXD1).	[7]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of PI-PLC X domain-containing protein 1 (PLCXD1).	[8]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of PI-PLC X domain-containing protein 1 (PLCXD1).	[9]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of PI-PLC X domain-containing protein 1 (PLCXD1).	[10]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of PI-PLC X domain-containing protein 1 (PLCXD1).	[11]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of PI-PLC X domain-containing protein 1 (PLCXD1).	[12]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of PI-PLC X domain-containing protein 1 (PLCXD1).	[13]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of PI-PLC X domain-containing protein 1 (PLCXD1).	[14]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Quercetin induced cell apoptosis and altered gene expression in AGS human gastric cancer cells. Environ Toxicol. 2018 Nov;33(11):1168-1181. doi: 10.1002/tox.22623. Epub 2018 Aug 27.
• [5] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [6] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [7] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [8] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [9] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [10] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [11] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [12] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [13] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [14] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.