Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUY564Y)

• DOT Name: Intraflagellar transport protein 22 homolog (IFT22)
• Synonyms: Rab-like protein 5
• Gene Name: IFT22
• UniProt ID: IFT22_HUMAN
• Pfam ID: PF08477
• Sequence:
  MLKAKILFVGPCESGKTVLANFLTESSDITEYSPTQGVRILEFENPHVTSNNKGTGCEFE
  LWDCGGDAKFESCWPALMKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLI
  AHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREE
  MSIMT
• Function: Small GTPase-like component of the intraflagellar transport (IFT) complex B.
• Reactome Pathway: Intraflagellar transport (R-HSA-5620924)

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Intraflagellar transport protein 22 homolog (IFT22).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Intraflagellar transport protein 22 homolog (IFT22).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Intraflagellar transport protein 22 homolog (IFT22).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Intraflagellar transport protein 22 homolog (IFT22).	[4]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Intraflagellar transport protein 22 homolog (IFT22).	[6]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Intraflagellar transport protein 22 homolog (IFT22).	[7]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Intraflagellar transport protein 22 homolog (IFT22).	[8]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Intraflagellar transport protein 22 homolog (IFT22).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Intraflagellar transport protein 22 homolog (IFT22).	[5]

References

• [1] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [5] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [6] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [7] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [8] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.