Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTW41L66)

• DOT Name: Transmembrane protein 50A (TMEM50A)
• Synonyms: Small membrane protein 1
• Gene Name: TMEM50A
• UniProt ID: TM50A_HUMAN
• Pfam ID: PF05255
• Sequence:
  MSGFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVIYPTMKDFNHSYHACG
  VIATIAFLMINAVSNGQVRGDSYSEGCLGQTGARIWLFVGFMLAFGSLIASMWILFGGYV
  AKEKDIVYPGIAVFFQNAFIFFGGLVFKFGRTEDLWQ

Molecular Interaction Atlas (MIA) of This DOT

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Transmembrane protein 50A (TMEM50A).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Transmembrane protein 50A (TMEM50A).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Transmembrane protein 50A (TMEM50A).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Transmembrane protein 50A (TMEM50A).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Transmembrane protein 50A (TMEM50A).	[5]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Transmembrane protein 50A (TMEM50A).	[6]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Transmembrane protein 50A (TMEM50A).	[7]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Transmembrane protein 50A (TMEM50A).	[8]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Transmembrane protein 50A (TMEM50A).	[9]
Forskolin	DM6ITNG	Investigative	Forskolin increases the expression of Transmembrane protein 50A (TMEM50A).	[9]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [3] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [8] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [9] Identification of genes targeted by the androgen and PKA signaling pathways in prostate cancer cells. Oncogene. 2006 Nov 23;25(55):7311-23.