General Information of Drug Off-Target (DOT) (ID: OTW52VNZ)

DOT Name Protein kinase C gamma type (PRKCG)
Synonyms PKC-gamma; EC 2.7.11.13
Gene Name PRKCG
Related Disease
Spinocerebellar ataxia type 14 ( )
UniProt ID
KPCG_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2E73; 2UZP
EC Number
2.7.11.13
Pfam ID
PF00130 ; PF00168 ; PF00069 ; PF00433
Sequence
MAGLGPGVGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
Function
Calcium-activated, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that plays diverse roles in neuronal cells and eye tissues, such as regulation of the neuronal receptors GRIA4/GLUR4 and GRIN1/NMDAR1, modulation of receptors and neuronal functions related to sensitivity to opiates, pain and alcohol, mediation of synaptic function and cell survival after ischemia, and inhibition of gap junction activity after oxidative stress. Binds and phosphorylates GRIA4/GLUR4 glutamate receptor and regulates its function by increasing plasma membrane-associated GRIA4 expression. In primary cerebellar neurons treated with the agonist 3,5-dihyidroxyphenylglycine, functions downstream of the metabotropic glutamate receptor GRM5/MGLUR5 and phosphorylates GRIN1/NMDAR1 receptor which plays a key role in synaptic plasticity, synaptogenesis, excitotoxicity, memory acquisition and learning. May be involved in the regulation of hippocampal long-term potentiation (LTP), but may be not necessary for the process of synaptic plasticity. May be involved in desensitization of mu-type opioid receptor-mediated G-protein activation in the spinal cord, and may be critical for the development and/or maintenance of morphine-induced reinforcing effects in the limbic forebrain. May modulate the functionality of mu-type-opioid receptors by participating in a signaling pathway which leads to the phosphorylation and degradation of opioid receptors. May also contributes to chronic morphine-induced changes in nociceptive processing. Plays a role in neuropathic pain mechanisms and contributes to the maintenance of the allodynia pain produced by peripheral inflammation. Plays an important role in initial sensitivity and tolerance to ethanol, by mediating the behavioral effects of ethanol as well as the effects of this drug on the GABA(A) receptors. During and after cerebral ischemia modulate neurotransmission and cell survival in synaptic membranes, and is involved in insulin-induced inhibition of necrosis, an important mechanism for minimizing ischemic injury. Required for the elimination of multiple climbing fibers during innervation of Purkinje cells in developing cerebellum. Is activated in lens epithelial cells upon hydrogen peroxide treatment, and phosphorylates connexin-43 (GJA1/CX43), resulting in disassembly of GJA1 gap junction plaques and inhibition of gap junction activity which could provide a protective effect against oxidative stress. Phosphorylates p53/TP53 and promotes p53/TP53-dependent apoptosis in response to DNA damage. Involved in the phase resetting of the cerebral cortex circadian clock during temporally restricted feeding. Stabilizes the core clock component BMAL1 by interfering with its ubiquitination, thus suppressing its degradation, resulting in phase resetting of the cerebral cortex clock.
Tissue Specificity Expressed in Purkinje cells of the cerebellar cortex.
KEGG Pathway
EGFR tyrosine ki.se inhibitor resistance (hsa01521 )
MAPK sig.ling pathway (hsa04010 )
ErbB sig.ling pathway (hsa04012 )
Ras sig.ling pathway (hsa04014 )
Rap1 sig.ling pathway (hsa04015 )
Calcium sig.ling pathway (hsa04020 )
HIF-1 sig.ling pathway (hsa04066 )
Phosphatidylinositol sig.ling system (hsa04070 )
Sphingolipid sig.ling pathway (hsa04071 )
mTOR sig.ling pathway (hsa04150 )
Vascular smooth muscle contraction (hsa04270 )
Wnt sig.ling pathway (hsa04310 )
VEGF sig.ling pathway (hsa04370 )
Focal adhesion (hsa04510 )
Gap junction (hsa04540 )
Neutrophil extracellular trap formation (hsa04613 )
.tural killer cell mediated cytotoxicity (hsa04650 )
Fc gamma R-mediated phagocytosis (hsa04666 )
Leukocyte transendothelial migration (hsa04670 )
Circadian entrainment (hsa04713 )
Long-term potentiation (hsa04720 )
Retrograde endocan.binoid sig.ling (hsa04723 )
Glutamatergic sy.pse (hsa04724 )
Cholinergic sy.pse (hsa04725 )
Serotonergic sy.pse (hsa04726 )
GABAergic sy.pse (hsa04727 )
Dopaminergic sy.pse (hsa04728 )
Long-term depression (hsa04730 )
Inflammatory mediator regulation of TRP channels (hsa04750 )
Insulin secretion (hsa04911 )
Melanogenesis (hsa04916 )
Thyroid hormone synthesis (hsa04918 )
Thyroid hormone sig.ling pathway (hsa04919 )
Oxytocin sig.ling pathway (hsa04921 )
Aldosterone synthesis and secretion (hsa04925 )
Parathyroid hormone synthesis, secretion and action (hsa04928 )
GnRH secretion (hsa04929 )
Growth hormone synthesis, secretion and action (hsa04935 )
Aldosterone-regulated sodium reabsorption (hsa04960 )
Endocrine and other factor-regulated calcium reabsorption (hsa04961 )
Salivary secretion (hsa04970 )
Gastric acid secretion (hsa04971 )
Pancreatic secretion (hsa04972 )
Spinocerebellar ataxia (hsa05017 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Amphetamine addiction (hsa05031 )
Morphine addiction (hsa05032 )
African trypanosomiasis (hsa05143 )
Amoebiasis (hsa05146 )
Hepatitis B (hsa05161 )
Human cytomegalovirus infection (hsa05163 )
Human immunodeficiency virus 1 infection (hsa05170 )
Coro.virus disease - COVID-19 (hsa05171 )
Pathways in cancer (hsa05200 )
Proteoglycans in cancer (hsa05205 )
MicroR.s in cancer (hsa05206 )
Chemical carcinogenesis - receptor activation (hsa05207 )
Glioma (hsa05214 )
Non-small cell lung cancer (hsa05223 )
Hepatocellular carcinoma (hsa05225 )
Choline metabolism in cancer (hsa05231 )
Diabetic cardiomyopathy (hsa05415 )
Reactome Pathway
Disinhibition of SNARE formation (R-HSA-114516 )
Trafficking of GluR2-containing AMPA receptors (R-HSA-416993 )
G alpha (z) signalling events (R-HSA-418597 )
WNT5A-dependent internalization of FZD4 (R-HSA-5099900 )
Response to elevated platelet cytosolic Ca2+ (R-HSA-76005 )
Calmodulin induced events (R-HSA-111933 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Spinocerebellar ataxia type 14 DISMGAYN Definitive Autosomal dominant [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Protein kinase C gamma type (PRKCG). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Protein kinase C gamma type (PRKCG). [8]
------------------------------------------------------------------------------------
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Protein kinase C gamma type (PRKCG). [3]
Triclosan DMZUR4N Approved Triclosan increases the expression of Protein kinase C gamma type (PRKCG). [4]
Pioglitazone DMKJ485 Approved Pioglitazone increases the expression of Protein kinase C gamma type (PRKCG). [5]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate decreases the expression of Protein kinase C gamma type (PRKCG). [6]
Bryostatin-1 DM1JOXY Phase 2 Bryostatin-1 decreases the expression of Protein kinase C gamma type (PRKCG). [7]
NSC-1771 DMNXDGQ Investigative NSC-1771 decreases the activity of Protein kinase C gamma type (PRKCG). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)
1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Rapamycin Immunosuppressant Drug DM678IB Investigative Rapamycin Immunosuppressant Drug increases the degradation of Protein kinase C gamma type (PRKCG). [9]
------------------------------------------------------------------------------------

References

1 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
4 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
5 Effects of metformin and pioglitazone combination on apoptosis and AMPK/mTOR signaling pathway in human anaplastic thyroid cancer cells. J Biochem Mol Toxicol. 2020 Oct;34(10):e22547. doi: 10.1002/jbt.22547. Epub 2020 Jun 26.
6 PKC delta-induced activation of MAPK pathway is required for bFGF-stimulated proliferation of coronary smooth muscle cells. Cardiovasc Res. 2005 Jul 1;67(1):142-50. doi: 10.1016/j.cardiores.2005.03.009. Epub 2005 Apr 12.
7 Modulation of protein kinase C activity and calcium-sensitive isoform expression in human myeloid leukemia cells by bryostatin 1: relationship to differentiation and ara-C-induced apoptosis. Exp Cell Res. 1996 Oct 10;228(1):65-75. doi: 10.1006/excr.1996.0300.
8 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
9 Mutant protein kinase C gamma that causes spinocerebellar ataxia type 14 (SCA14) is selectively degraded by autophagy. Genes Cells. 2010 May;15(5):425-38. doi: 10.1111/j.1365-2443.2010.01395.x. Epub 2010 Apr 11.
10 PKC sulfhydryl targeting by disulfiram produces divergent isozymic regulatory responses that accord with the cancer preventive activity of the thiuram disulfide. Antioxid Redox Signal. 2005 Jul-Aug;7(7-8):855-62. doi: 10.1089/ars.2005.7.855.