Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTW646HP)

DOT Name	Protein LSM14 homolog B (LSM14B)
Synonyms	RNA-associated protein 55B; hRAP55B
Gene Name	LSM14B
UniProt ID	LS14B_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF09532 ; PF12701
Sequence	MSGSSGTPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPR EEIYEYIIFRGSDIKDITVCEPPKAQHTLPQDPAIVQSSLGSASASPFQPHVPYSPFRGM APYGPLAASSLLSQQYAASLGLGAGFPSIPVGKSPMVEQAVQTGSADNLNAKKLLPGKGT TGTQLNGRQAQPSSKTASDVVQPAAVQAQGQVNDENRRPQRRRSGNRRTRNRSRGQNRPT NVKENTIKFEGDFDFESANAQFNREELDKEFKKKLNFKDDKAEKGEEKDLAVVTQSAEAP AEEDLLGPNCYYDKSKSFFDNISSELKTSSRRTTWAEERKLNTETFGVSGRFLRGRSSRG GFRGGRGNGTTRRNPTSHRAGTGRV
Function	Required for oocyte meiotic maturation. May be involved in the storage of translationally inactive mRNAs and protect them from degradation. Plays a role in control of mRNA translation.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein LSM14 homolog B (LSM14B).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein LSM14 homolog B (LSM14B).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein LSM14 homolog B (LSM14B).	[3]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Protein LSM14 homolog B (LSM14B).	[4]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Protein LSM14 homolog B (LSM14B).	[5]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Protein LSM14 homolog B (LSM14B).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Protein LSM14 homolog B (LSM14B).	[7]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of Protein LSM14 homolog B (LSM14B).	[9]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Protein LSM14 homolog B (LSM14B).	[10]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Protein LSM14 homolog B (LSM14B).	[11]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Protein LSM14 homolog B (LSM14B).	[12]
------------------------------------------------------------------------------------


⏷ Show the Full List of 11 Drug(s)

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Protein LSM14 homolog B (LSM14B).	[8]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Protein LSM14 homolog B (LSM14B).	[8]
------------------------------------------------------------------------------------

References

1	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
3	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
5	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
6	Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
7	Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
8	Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
9	Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
10	Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
11	Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
12	From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.