| DOT Name |
Microtubule nucleation factor SSNA1 (SSNA1)
|
| Synonyms |
Nuclear autoantigen of 14 kDa; Sjoegren syndrome nuclear autoantigen 1 |
| Gene Name |
SSNA1
|
| Related Disease |
- Peeling skin syndrome 1 ( )
- Potocki-Shaffer syndrome ( )
- Systemic sclerosis ( )
|
| UniProt ID |
|
| 3D Structure |
|
| Sequence |
MTQQGAALQNYNNELVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNEN
LARKIASRNEFDRTIAETEAAYLKILESSQTLLSVLKREAGNLTKATAPDQKSSGGRDS
|
| Function |
Microtubule-binding protein which stabilizes dynamic microtubules by slowing growth and shrinkage at both plus and minus ends and serves as a sensor of microtubule damage, protecting microtubules from the microtubule-severing enzyme SPAST. Induces microtubule branching which is mediated by the formation of long SSNA1 fibrils which guide microtubule protofilaments to split apart from the mother microtubule and form daughter microtubules. Plays a role in axon outgrowth and branching. Required for cell division.
|
| Tissue Specificity |
Widely expressed. |
| Reactome Pathway |
- Loss of Nlp from mitotic centrosomes (R-HSA-380259 )
- Recruitment of mitotic centrosome proteins and complexes (R-HSA-380270 )
- Loss of proteins required for interphase microtubule organization from the centrosome (R-HSA-380284 )
- Recruitment of NuMA to mitotic centrosomes (R-HSA-380320 )
- Anchoring of the basal body to the plasma membrane (R-HSA-5620912 )
- AURKA Activation by TPX2 (R-HSA-8854518 )
- Regulation of PLK1 Activity at G2/M Transition (R-HSA-2565942 )
|
|
|
|
|
|
|
