Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWF8EEF)

• DOT Name: Uncharacterized protein C3orf62 (C3ORF62)
• Gene Name: C3ORF62
• Related Disease: Soft tissue neoplasm
• UniProt ID: CC062_HUMAN
• Pfam ID: PF15830
• Sequence:
  MHYIKTWSLLGEMSEKLRRCRKELTAAIDRAFEGVSYSQECTGQQRLELSAAPLSFSLPV
  HRLLCRRHPLAACSSAAPFAAVPCAPENENPAFATNHAPVNAKPHALCPERKPLTSKENV
  LMHSSILAPERESWRTAGEGENWRKENLRKDMERDLKADSNMPLNNSSQEVTKDLLDMID
  HTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKATDADPGSLKQAF
  DDHNIVETVLDLEEDYNVMTSFKYQIE
• Function: Essential for normal spermatogenesis and male fertility.
• Tissue Specificity: Testis. Down-regulated in men with spermatocyte arrest.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Soft tissue neoplasm	DISP2OHE	Strong	Genetic Variation	[1]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Uncharacterized protein C3orf62 (C3ORF62).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Uncharacterized protein C3orf62 (C3ORF62).	[3]
Decitabine	DMQL8XJ	Approved	Decitabine decreases the expression of Uncharacterized protein C3orf62 (C3ORF62).	[4]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Uncharacterized protein C3orf62 (C3ORF62).	[5]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Uncharacterized protein C3orf62 (C3ORF62).	[8]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Uncharacterized protein C3orf62 (C3ORF62).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Uncharacterized protein C3orf62 (C3ORF62).	[7]

References

• [1] Recurrent SRF-RELA Fusions Define a Novel Subset of Cellular Myofibroma/Myopericytoma: A Potential Diagnostic Pitfall With Sarcomas With Myogenic Differentiation.Am J Surg Pathol. 2017 May;41(5):677-684. doi: 10.1097/PAS.0000000000000811.
• [2] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] DNA methylation inhibits p53-mediated survivin repression. Oncogene. 2009 May 14;28(19):2046-50. doi: 10.1038/onc.2009.62. Epub 2009 Apr 13.
• [5] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [8] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.