Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWPVI29)

DOT Name GAS2-like protein 3 (GAS2L3)
Synonyms Growth arrest-specific protein 2-like 3
Gene Name GAS2L3
UniProt ID
GA2L3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00307 ; PF02187
Sequence
MQPAIQVWFGEDLPLSPRSPLTPRHGPGLANVCQYDEWIAVRHEATLLPMQEDLSIWLSG
LLGIKVKAEKLLEELDNGVLLCQLIDVLQNMVKTCNSEESGNFPMRKVPCKKDAASGSFF
ARDNTANFLHWCRDIGVDETYLFESEGLVLHKDPRQVYLCLLEIGRIVSRYGVEPPVLVK
LEKEIELEETLLNTSGPEDSISIPKSCCRHEELHEAVKHIAEDPPCSCSHRFSIEYLSEG
RYRLGDKILFIRMLHGKHVMVRVGGGWDTLQGFLLKYDPCRILQFATLEQKILAFQKGVS
NESVPDSPARTPQPPEMNPLSAVNMFQKQNSKPSVPVSIPKSKEKQGRPPGALVPASSLK
GGNLGSMSVRSKLPNSPAASSHPKLKSSKGITKKPQAPSNNASSSLASLNPVGKNTSSPA
LPRTAPCISESPRKCISSPNTPKAKVIPAQNSADLPESTLLPNKCSGKTQPKYLKHNHIS
SRDNAVSHLAAHSNSSSKCPKLPKANIPVRPKPSFQSSAKMTKTSSKTIATGLGTQSQPS
DGAPQAKPVPAQKLKSALNLNQPVSVSSVSPVKATQKSKDKNIVSATKKQPQNKSAFQKT
GPSSLKSPGRTPLSIVSLPQSSTKTQTAPKSAQTVAKSQHSTKGPPRSGKTPASIRKPPS
SVKDADSGDKKPTAKKKEDDDHYFVMTGSKKPRK
Function Cytoskeletal linker protein. May promote and stabilize the formation of the actin and microtubule network.
Tissue Specificity Expressed in the pancreas, heart, liver, placenta, brain, skeletal muscle, kidney and lung.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of GAS2-like protein 3 (GAS2L3). [1]
------------------------------------------------------------------------------------
17 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of GAS2-like protein 3 (GAS2L3). [2]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of GAS2-like protein 3 (GAS2L3). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of GAS2-like protein 3 (GAS2L3). [4]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of GAS2-like protein 3 (GAS2L3). [5]
Estradiol DMUNTE3 Approved Estradiol increases the expression of GAS2-like protein 3 (GAS2L3). [6]
Quercetin DM3NC4M Approved Quercetin decreases the expression of GAS2-like protein 3 (GAS2L3). [7]
Temozolomide DMKECZD Approved Temozolomide increases the expression of GAS2-like protein 3 (GAS2L3). [8]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of GAS2-like protein 3 (GAS2L3). [9]
Testosterone DM7HUNW Approved Testosterone decreases the expression of GAS2-like protein 3 (GAS2L3). [9]
Progesterone DMUY35B Approved Progesterone decreases the expression of GAS2-like protein 3 (GAS2L3). [10]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of GAS2-like protein 3 (GAS2L3). [11]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of GAS2-like protein 3 (GAS2L3). [12]
Dasatinib DMJV2EK Approved Dasatinib decreases the expression of GAS2-like protein 3 (GAS2L3). [13]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of GAS2-like protein 3 (GAS2L3). [14]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of GAS2-like protein 3 (GAS2L3). [15]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of GAS2-like protein 3 (GAS2L3). [16]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of GAS2-like protein 3 (GAS2L3). [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
6 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
7 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
8 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
9 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
10 Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
11 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
12 CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
13 Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
14 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
15 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
16 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
17 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.