Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTX3KR7U)

DOT Name Complement component receptor 1-like protein (CR1L)
Synonyms Complement C4b-binding protein CR-1-like protein
Gene Name CR1L
Related Disease
Alzheimer disease ( )
UniProt ID
CR1L_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00084
Sequence
MAPPVRLERPFPSRRFPGLLLAALVLLLSSFSDQCNVPEWLPFARPTNLTDDFEFPIGTY
LNYECRPGYSGRPFSIICLKNSVWTSAKDKCKRKSCRNPPDPVNGMAHVIKDIQFRSQIK
YSCPKGYRLIGSSSATCIISGNTVIWDNKTPVCDRIICGLPPTIANGDFTSISREYFHYG
SVVTYHCNLGSRGKKVFELVGEPSIYCTSKDDQVGIWSGPAPQCIIPNKCTPPNVENGIL
VSDNRSLFSLNEVVEFRCQPGFGMKGPSHVKCQALNKWEPELPSCSRVCQPPPDVLHAER
TQRDKDNFSPGQEVFYSCEPGYDLRGSTYLHCTPQGDWSPAAPRCEVKSCDDFLGQLPNG
HVLFPLNLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCERKSCETPPVPV
NGMVHVITDIHVGSRINYSCTTGHRLIGHSSAECILSGNTAHWSMKPPICQQIFCPNPPA
ILNGRHTGTPLGDIPYGKEVSYTCDPHPDRGMTFNLIGESTIRRTSEPHGNGVWSSPAPR
CELPVGAGSHDALIVGKFYEVFAEEFCHL
Tissue Specificity Expressed in fetal liver and to a lesser extent in fetal spleen and thymus. Expression appears to be limited to hematopoietic and fetal lymphoid tissue.
KEGG Pathway
Complement and coagulation cascades (hsa04610 )
Neutrophil extracellular trap formation (hsa04613 )
Hematopoietic cell lineage (hsa04640 )
Legionellosis (hsa05134 )
Leishmaniasis (hsa05140 )
Malaria (hsa05144 )
Tuberculosis (hsa05152 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Alzheimer disease DISF8S70 Strong Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Complement component receptor 1-like protein (CR1L). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Complement component receptor 1-like protein (CR1L). [5]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Complement component receptor 1-like protein (CR1L). [6]
------------------------------------------------------------------------------------
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Complement component receptor 1-like protein (CR1L). [3]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Complement component receptor 1-like protein (CR1L). [4]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Complement component receptor 1-like protein (CR1L). [4]
Belinostat DM6OC53 Phase 2 Belinostat increases the expression of Complement component receptor 1-like protein (CR1L). [4]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Complement component receptor 1-like protein (CR1L). [7]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Complement component receptor 1-like protein (CR1L). [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 GWAS on family history of Alzheimer's disease.Transl Psychiatry. 2018 May 18;8(1):99. doi: 10.1038/s41398-018-0150-6.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
5 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
6 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
7 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
8 Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.