Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXCR0SB)

• DOT Name: Lymphocyte antigen 6D (LY6D)
• Synonyms: Ly-6D; E48 antigen
• Gene Name: LY6D
• UniProt ID: LY6D_HUMAN
• Pfam ID: PF00021
• Sequence:
  MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVK
  KDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLL
  AVILAPSL
• Function: May act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. Marks the earliest stage of B-cell specification.
• Tissue Specificity: Expressed exclusively at the outer cell surface of transitional epithelia and the keratinocyte of stratified squamous epithelia.
• Reactome Pathway: Post-translational modification (R-HSA-163125)

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Lymphocyte antigen 6D (LY6D).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Lymphocyte antigen 6D (LY6D).	[9]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Lymphocyte antigen 6D (LY6D).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Lymphocyte antigen 6D (LY6D).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Lymphocyte antigen 6D (LY6D).	[4]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Lymphocyte antigen 6D (LY6D).	[5]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Lymphocyte antigen 6D (LY6D).	[6]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Lymphocyte antigen 6D (LY6D).	[7]
OTX-015	DMI8RG1	Phase 1/2	OTX-015 decreases the expression of Lymphocyte antigen 6D (LY6D).	[8]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Lymphocyte antigen 6D (LY6D).	[8]
Mivebresib	DMCPF90	Phase 1	Mivebresib decreases the expression of Lymphocyte antigen 6D (LY6D).	[8]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [3] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [4] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [5] Arsenic alters transcriptional responses to Pseudomonas aeruginosa infection and decreases antimicrobial defense of human airway epithelial cells. Toxicol Appl Pharmacol. 2017 Sep 15;331:154-163.
• [6] Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
• [7] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [8] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
• [9] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.