Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXXBBQT)

• DOT Name: Enkurin (ENKUR)
• Gene Name: ENKUR
• Related Disease:
  Colorectal carcinoma
  Leukocyte adhesion deficiency type 1
  Lung adenocarcinoma
  Neoplasm
  Advanced cancer
• UniProt ID: ENKUR_HUMAN
• PDB ID: 7UNG; 8J07
• Pfam ID: PF13864
• Sequence:
  MDPTCSSECIYNLIPSDLKEPPQPPRYISIFKATVKDDMQKAKTAMKTMGPAKVEVPSPK
  DFLKKHSKEKTLPPKKNFDRNVPKKPAVPLKTDHPVMGIQSGKNFINTNAADIIMGVAKK
  PKPIYVDKRTGDKHDLEPSGLVPKYINKKDYGVTPEYICKRNEEIKKAQEDYDRYIQENL
  KKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSIPKKIRKQRLEEEMKQLEHD
  IGIIEKHKIIYIANNA
• Function: Adapter that functions to localize a calcium-sensitive signal transduction machinery in sperm to a calcium-permeable ion channel. Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating.
• Tissue Specificity: Expressed in airway epithelial cells.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[1]
Leukocyte adhesion deficiency type 1	DISA1J7W	Strong	Altered Expression	[2]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[2]
Neoplasm	DISZKGEW	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Limited	Altered Expression	[1]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Enkurin (ENKUR).	[3]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Enkurin (ENKUR).	[4]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Enkurin (ENKUR).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Enkurin (ENKUR).	[6]

References

• [1] ENKUR Is Involved in the Regulation of Cellular Biology in Colorectal Cancer Cells via PI3K/Akt Signaling Pathway.Technol Cancer Res Treat. 2019 Jan 1;18:1533033819841433. doi: 10.1177/1533033819841433.
• [2] ENKUR acts as a tumor suppressor in lung adenocarcinoma cells through PI3K/Akt and MAPK/ERK signaling pathways.J Cancer. 2019 Jul 5;10(17):3975-3984. doi: 10.7150/jca.30021. eCollection 2019.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [5] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [6] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.