Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTY39R4P)

DOT Name INO80 complex subunit D (INO80D)
Gene Name INO80D
Related Disease
Non-small-cell lung cancer ( )
UniProt ID
IN80D_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13891
Sequence
MYEGKHIHFSEVDNKPLCSYSPKLCKQRRLNGYAFCIRHVLEDKTAPFKQCEYVAKYNSQ
RCTNPIPKSEDRRYCNSHLQVLGFIPKKERKKKNDPIDEVKVRHQMDTMAFSLTVPTLAL
KMPNGLDGMSLSPPGARVPLHYLETELEDPFAFNEEDDDLKKGATVRKKLQSKLAQNRQR
QRETEILKVRQEHFSPPPAPSQQQPPQQHSHLSPLSTSLKPPAPPQGSVCKSPQPQNTSL
PMQGVAPTTHTIAQARQLSHKRPLPLLPSSRAPTVDPPRTDRILMKATAFSPHFSCISRL
QRLVKLCTQKHQLDTDLFPHLGLDWSEESGEEPEDSEQASPYQVAWSIRETLRYQRHASD
DDDAESRSSRVTQLCTYFQQKYKHLCRLERAESRQKKCRHTFRKALLQAASKEPECTGQL
IQELRRAACSRTSISRTKLREVEPAACSGTVKGEQCANKALPFTRHCFQHILLNHSQQLF
SSCTAKFADGQQCSVPVFDITHQTPLCEEHAKKMDNFLRGDNSRKVQHQQQRKPRKKTKP
PALTKKHKKKRRRGPRRPQKPIPPAVPQGNLSMPASVSLPVEASHIRSPSTPELSADELP
DDIANEITDIPHDLELNQEDFSDVLPRLPDDLQDFDFFEGKNGDLLPTTEEAEELERALQ
AVTSLECLSTIGVLAQSDGVPVQELSDRGIGVFSTGTGASGIQSLSREVNTDLGELLNGR
IVHDNFSSLELDENLLRSATLSNPPTPLAGQIQGQFSAPANVGLTSATLISQSALGERAF
PGQFHGLHDGSHASQRPHPAQLLSKADDLITSRQQYSSDHSHSSPHGSHYDSEHVPSPYS
DHITSPHTTSYSGDNMAATFSAEMPIMAQHLLPTQLEVPLGGVVNPRTHWGNLPVNLGDP
SPFSNLLGADGHLLSTSLSTPPTTSNSETTQPAFATVTPSSSSVLPGLPQTSFSGMGPSA
ELMASTSPKQQLPQFSAAFGHQLSSHSGIPKDLQPSHSSIAPPTGFTVTGATATSTNNAS
SPFPSPN
Function Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.
KEGG Pathway
ATP-dependent chromatin remodeling (hsa03082 )
Reactome Pathway
DNA Damage Recognition in GG-NER (R-HSA-5696394 )
UCH proteinases (R-HSA-5689603 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
16 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of INO80 complex subunit D (INO80D). [2]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of INO80 complex subunit D (INO80D). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of INO80 complex subunit D (INO80D). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of INO80 complex subunit D (INO80D). [5]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of INO80 complex subunit D (INO80D). [6]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of INO80 complex subunit D (INO80D). [7]
Marinol DM70IK5 Approved Marinol increases the expression of INO80 complex subunit D (INO80D). [8]
Rifampicin DM5DSFZ Approved Rifampicin decreases the expression of INO80 complex subunit D (INO80D). [9]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of INO80 complex subunit D (INO80D). [10]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of INO80 complex subunit D (INO80D). [11]
Torcetrapib DMDHYM7 Discontinued in Phase 2 Torcetrapib increases the expression of INO80 complex subunit D (INO80D). [13]
Scriptaid DM9JZ21 Preclinical Scriptaid decreases the expression of INO80 complex subunit D (INO80D). [7]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of INO80 complex subunit D (INO80D). [14]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of INO80 complex subunit D (INO80D). [15]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of INO80 complex subunit D (INO80D). [16]
Octanedioic acid bis-hydroxyamide DMJNQ9K Investigative Octanedioic acid bis-hydroxyamide decreases the expression of INO80 complex subunit D (INO80D). [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 16 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of INO80 complex subunit D (INO80D). [12]
------------------------------------------------------------------------------------

References

1 Genome-wide analysis of lncRNAs in 3'-untranslated regions: CR933609 acts as a decoy to protect the INO80D gene.Int J Oncol. 2018 Jul;53(1):417-433. doi: 10.3892/ijo.2018.4398. Epub 2018 May 8.
2 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
4 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
7 Development and validation of the TGx-HDACi transcriptomic biomarker to detect histone deacetylase inhibitors in human TK6 cells. Arch Toxicol. 2021 May;95(5):1631-1645. doi: 10.1007/s00204-021-03014-2. Epub 2021 Mar 26.
8 Delta9-tetrahydrocannabinol inhibits cytotrophoblast cell proliferation and modulates gene transcription. Mol Hum Reprod. 2006 May;12(5):321-33. doi: 10.1093/molehr/gal036. Epub 2006 Apr 5.
9 Integrated analysis of rifampicin-induced microRNA and gene expression changes in human hepatocytes. Drug Metab Pharmacokinet. 2014;29(4):333-40.
10 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
11 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
12 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
13 Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
14 Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.
15 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
16 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.