Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZJDFWK)

• DOT Name: STEAP family member 1B (STEAP1B)
• Gene Name: STEAP1B
• Related Disease:
  Alzheimer disease
  Neoplasm of esophagus
• UniProt ID: STEAL_HUMAN
• Pfam ID: PF01794
• Sequence:
  MESRKDITNQEEIWKMKPRRNLEDNDYLQTAHADEFDCPSELQHAQELFPQWHLPIKIAA
  VMASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIV
  QVHNGTKYKKFPHWLDKWMLTRKQFGLLSLFFAVLHAIYTLSYAMRRSYRYKLLNWAYQQ
  VQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQVHGRI
  NFLTL

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[1]
Neoplasm of esophagus	DISOLKAQ	Limited	Genetic Variation	[2]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of STEAP family member 1B (STEAP1B).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of STEAP family member 1B (STEAP1B).	[4]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of STEAP family member 1B (STEAP1B).	[5]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of STEAP family member 1B (STEAP1B).	[6]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of STEAP family member 1B (STEAP1B).	[7]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of STEAP family member 1B (STEAP1B).	[5]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of STEAP family member 1B (STEAP1B).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of STEAP family member 1B (STEAP1B).	[8]

References

• [1] A potential endophenotype for Alzheimer's disease: cerebrospinal fluid clusterin.Neurobiol Aging. 2016 Jan;37:208.e1-208.e9. doi: 10.1016/j.neurobiolaging.2015.09.009. Epub 2015 Sep 25.
• [2] Genome-wide association analyses of esophageal squamous cell carcinoma in Chinese identify multiple susceptibility loci and gene-environment interactions.Nat Genet. 2012 Oct;44(10):1090-7. doi: 10.1038/ng.2411. Epub 2012 Sep 9.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [5] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [6] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [7] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.