Details of the Drug

General Information of Drug (ID: DM295PR)

Drug Name
Ofatumumab
Synonyms Arzerra (TN)
Indication
Disease Entry ICD 11 Status REF
Chronic lymphocytic leukaemia 2A82.0 Approved [1]
Small lymphocytic lymphoma 2A82.0 Approved [2]
Diffuse large B-cell lymphoma 2A81 Phase 3 [1]
Non-hodgkin lymphoma 2B33.5 Phase 3 [3]
Rheumatoid arthritis FA20 Phase 2 [1]
Drug Type
Antibody
Sequence
>heavy chain
EVQLVESGGGLVQPGRSLRLSCAASGFTFNDYAMHWVRQAPGKGLEWVSTISWNSGSIGY
ADSVKGRFTISRDNAKKSLYLQMNSLRAEDTALYYCAKDIQYGNYYYGMDVWGQGTTVTV
SSASTKGPSVFPLAPGSSKSTSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
>light chain
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPITFGQGTRLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
ADMET Property
Absorption Cmax
The maximum plasma concentration (Cmax) of drug is 94 mg/L [4]
Absorption Tmax
The time to maximum plasma concentration (Tmax) is 7.3 h [4]
Clearance
The clearance of drug is 11.6 mL/h [5]
Half-life
The concentration or amount of drug in body reduced by one-half in 17.1 days [5]
Metabolism
The drug is metabolized via the reticuloendothelial system and protein catabolism by a target\mediated disposition pathway [6]
Vd
The volume of distribution (Vd) of drug is 5.8 L [5]
Cross-matching ID
DrugBank ID
DB06650
TTD ID
D0Y8ZN
Repurposed Drugs (RPD) Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Leukocyte surface antigen Leu-16 (CD20) TTUE541 CD20_HUMAN Not Available [7]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Ofatumumab (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Teriflunomide DMQ2FKJ Major Additive myelosuppressive effects by the combination of Ofatumumab and Teriflunomide. Hyper-lipoproteinaemia [5C80] [8]
Tecfidera DM2OVDT Moderate Additive immunosuppressive effects by the combination of Ofatumumab and Tecfidera. Multiple sclerosis [8A40] [9]
Siponimod DM2R86O Major Additive immunosuppressive effects by the combination of Ofatumumab and Siponimod. Multiple sclerosis [8A40] [10]
Fingolimod DM5JVAN Major Additive immunosuppressive effects by the combination of Ofatumumab and Fingolimod. Multiple sclerosis [8A40] [11]
Ocrelizumab DMEZ2KH Moderate Additive immunosuppressive effects by the combination of Ofatumumab and Ocrelizumab. Multiple sclerosis [8A40] [12]
Ozanimod DMT6AM2 Major Additive immunosuppressive effects by the combination of Ofatumumab and Ozanimod. Multiple sclerosis [8A40] [13]
Golimumab DMHZV7X Major Additive immunosuppressive effects by the combination of Ofatumumab and Golimumab. Rheumatoid arthritis [FA20] [14]
Anthrax vaccine DM9GSWY Moderate Antagonize the effect of Ofatumumab when combined with Anthrax vaccine. Sepsis [1G40-1G41] [15]
⏷ Show the Full List of 8 DDI Information of This Drug

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6778).
2 Final analysis from RESONATE: Up to six years of follow-up on ibrutinib in patients with previously treated chronic lymphocytic leukemia or small lymphocytic lymphoma. Am J Hematol. 2019 Dec;94(12):1353-1363.
3 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
4 Ogura M, Hatake K, Tobinai K, Uchida T, Suzuki T, Terui Y, Yokoyama M, Maruyama D, Mori M, Jewell RC, Katsura K, Hotta T: Phase I study of ofatumumab, a human anti-CD20 antibody, in Japanese patients with relapsed or refractory chronic lymphocytic leukemia and small lymphocytic lymphoma. Jpn J Clin Oncol. 2013 May;43(5):466-75. doi: 10.1093/jjco/hyt022. Epub 2013 Feb 28.
5 FDA Approved Drug Products: ARZERRA (ofatumumab) injection, for intravenous use
6 Veve MP, Wagner JL: Lefamulin: Review of a Promising Novel Pleuromutilin Antibiotic. Pharmacotherapy. 2018 Sep;38(9):935-946. doi: 10.1002/phar.2166. Epub 2018 Aug 20.
7 Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
8 Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
9 Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA.
10 Cerner Multum, Inc. "Australian Product Information.".
11 Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
12 Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
13 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
14 Product Information. Cimzia (certolizumab). UCB Pharma Inc, Smyrna, GA.
15 CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]