Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT27RFC)

DTT Name Opioid receptor delta (OPRD1)
Synonyms OPRD; Delta-type opioid receptor; Delta opioid receptor; DOR-1; D-OR-1
Gene Name OPRD1
DTT Type
Successful target
 [1]
BioChemical Class
GPCR rhodopsin
UniProt ID
OPRD_HUMAN
TTD ID
T58992
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
Function
Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain and in opiate-mediated analgesia. Plays a role in developing analgesic tolerance to morphine. G-protein coupled receptor that functions as receptor for endogenous enkephalins and for a subset of other opioids.
KEGG Pathway
cGMP-PKG signaling pathway (hsa04022 )
Sphingolipid signaling pathway (hsa04071 )
Neuroactive ligand-receptor interaction (hsa04080 )
Reactome Pathway
G alpha (i) signalling events (R-HSA-418594 )
Peptide ligand-binding receptors (R-HSA-375276 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
6 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Butorphanol DM5KYPJ Pain MG30-MG3Z Approved [2]
Codeine DMJX6ZG Allergic rhinitis CA08.0 Approved [2]
Eluxadoline DMYZ0P1 Diarrhea-predominant irritable bowel syndrome DD91.01 Approved [3]
Hydromorphone DMHP21E Back pain ME84.Z Approved [4]
Loperamide DMOJZQ9 Diarrhea ME05.1 Approved [5]
Oxycodone DMXLKHV Osteoarthritis FA00-FA05 Approved [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Approved Drug(s)
10 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
ADL-5747 DMMUPTN Pain MG30-MG3Z Phase 2 [6]
ADL-5859 DMDQH9A Rheumatoid arthritis FA20 Phase 2 [6]
AZD-2327 DM8FZOG Anxiety disorder 6B00-6B0Z Phase 2 [7]
Carfentanil DM7ADGX N. A. N. A. Phase 2 [8]
Met-enkephalin DMSZFTP Pain MG30-MG3Z Phase 2 [9]
AIKO-150 DMW9ZFS Opioid dependence 6C43.2Z Phase 1 [10]
MCP-201 DMW9YOJ Pain MG30-MG3Z Phase 1 [11]
MCP-202 DM65B7G Overactive bladder GC50.0 Phase 1 [12]
SALVINORIN A DMJ3HQY Cerebral vasospasm BA85.Z Phase 1 [13]
TRV250 DM2WZ86 Migraine 8A80 Phase 1 [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Clinical Trial Drug(s)
9 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
DPI-3290 DMKGXT2 Pain MG30-MG3Z Discontinued in Phase 2 [15]
Dynorphin a DMT2WVP N. A. N. A. Discontinued in Phase 2 [16]
TRK-851 DMZ5RA7 Cough MD12 Discontinued in Phase 1 [17]
VP004 DMXK8FQ Substance use disorder 6C4Z Discontinued in Phase 1 [18]
BIPHALIN DMKNS10 N. A. N. A. Terminated [22]
BW 373U86 DMXFZWJ N. A. N. A. Terminated [23]
SB-213698 DM58PKG N. A. N. A. Terminated [24]
SB-219825 DMQW6B0 Pain MG30-MG3Z Terminated [25]
SNF-9007 DM4CNM9 N. A. N. A. Terminated [26]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Discontinued Drug(s)
3 Preclinical Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
BIO-306 DMPUBK8 Migraine 8A80 Preclinical [19]
LY-25582 DM2N637 Obesity 5B81 Preclinical [20]
SoRI-9409 DMSNX4O Alcohol dependence 6C40.2 Preclinical [21]
------------------------------------------------------------------------------------
373 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(-)-cyclorphan DMC8WS4 Discovery agent N.A. Investigative [27]
(-)-eseroline DMJD34Q Discovery agent N.A. Investigative [28]
(-)-isoelaeocarpiline DMJS6IZ Discovery agent N.A. Investigative [29]
(H-Dmt-Tic-Glu-NH-(CH(2))(5)-CO-Dap(6DMN)-NH(2) DMSCQ64 Discovery agent N.A. Investigative [30]
1,10-bis-(Dmt-Tic-amino)decane DM9UGFQ Discovery agent N.A. Investigative [31]
1,4-bis-(Dmt-Tic-amino)butane DMLBHXN Discovery agent N.A. Investigative [31]
1,6-bis-(Dmt-Tic-amino)hexane DMRG2CU Discovery agent N.A. Investigative [31]
1,6-bis-(N,N-dimethyl-Dmt-Tic-NH)hexane DMMUZK9 Discovery agent N.A. Investigative [31]
1-(1,2-diphenylethyl)-4-phenylpiperidin-4-ol DMOR9EK Discovery agent N.A. Investigative [32]
1-(2-ethoxy-1-phenylethyl)-4-phenylpiperidin-4-ol DMV3FSH Discovery agent N.A. Investigative [32]
1-(dio-tolylmethyl)-4-phenylpiperidin-4-ol DMLYO8P Discovery agent N.A. Investigative [32]
1-benzhydryl-4-(2-fluorophenyl)piperidin-4-ol DMTANPG Discovery agent N.A. Investigative [33]
1-benzhydryl-4-(2-methoxyphenyl)piperidin-4-ol DMWHMNY Discovery agent N.A. Investigative [33]
1-benzhydryl-4-(3-fluorophenyl)piperidin-4-ol DMXZFPB Discovery agent N.A. Investigative [33]
1-benzhydryl-4-(3-methoxyphenyl)piperidin-4-ol DM1QYS8 Discovery agent N.A. Investigative [33]
1-benzhydryl-4-(3-phenylpropyl)piperidin-4-ol DMIT7SH Discovery agent N.A. Investigative [33]
1-benzhydryl-4-(4-bromophenyl)piperidin-4-ol DM0BQYX Discovery agent N.A. Investigative [33]
1-benzhydryl-4-(4-chlorophenyl)piperidin-4-ol DMWYG8K Discovery agent N.A. Investigative [33]
1-benzhydryl-4-(4-fluorophenyl)piperidin-4-ol DMRNZD6 Discovery agent N.A. Investigative [33]
1-benzhydryl-4-(4-methoxyphenyl)piperidin-4-ol DMXT894 Discovery agent N.A. Investigative [33]
1-benzhydryl-4-(benzyloxy)-4-phenylpiperidine DMDRUBL Discovery agent N.A. Investigative [32]
1-benzhydryl-4-(furan-2-yl)piperidin-4-ol DMMB2GV Discovery agent N.A. Investigative [33]
1-benzhydryl-4-(thiophen-2-yl)piperidin-4-ol DMNOZR2 Discovery agent N.A. Investigative [33]
1-benzhydryl-4-benzylpiperidin-4-ol DMVBR36 Discovery agent N.A. Investigative [33]
1-benzhydryl-4-butylpiperidin-4-ol DMRN7SC Discovery agent N.A. Investigative [33]
1-benzhydryl-4-cyclohexylpiperidin-4-ol DMZVSYD Discovery agent N.A. Investigative [33]
1-benzhydryl-4-ethoxy-4-phenylpiperidine DM6PIL2 Discovery agent N.A. Investigative [32]
1-benzhydryl-4-hexylpiperidin-4-ol DMUK95S Discovery agent N.A. Investigative [33]
1-benzhydryl-4-m-tolylpiperidin-4-ol DMVJH1S Discovery agent N.A. Investigative [33]
1-benzhydryl-4-methoxy-4-phenylpiperidine DMBG0N8 Discovery agent N.A. Investigative [32]
1-benzhydryl-4-o-tolylpiperidin-4-ol DMVUMSF Discovery agent N.A. Investigative [33]
1-benzhydryl-4-p-tolylpiperidin-4-ol DM679RC Discovery agent N.A. Investigative [33]
1-benzhydryl-4-phenyl-4-propoxypiperidine DMEB968 Discovery agent N.A. Investigative [32]
1-benzhydryl-4-phenylpiperidin-4-ol DM7KU1X Discovery agent N.A. Investigative [34]
1-[3-(3-biphenyl)-(1,2,4-triazol-4-yl) ]-3-phenol DMLRS8I Discovery agent N.A. Investigative [35]
1-[3-(4-biphenyl)-(1,2,4-triazol-4-yl) ]-3-phenol DMB1NF0 Discovery agent N.A. Investigative [35]
14-O-phenylpropylnaltrexone DMI7LXH Discovery agent N.A. Investigative [36]
17-(Cyclobutylmethyl)-N-phenylmorphinan-3-amine DMUQWPZ Discovery agent N.A. Investigative [37]
17-(Cyclopropylmethyl)-N-phenylmorphinan-3-amine DM174HN Discovery agent N.A. Investigative [37]
17-methyl-4'-methyldihydromorphinone DMMEB64 Discovery agent N.A. Investigative [38]
17-Methylmorphinan-3-yl 4-Iodophenyl Carbamate DMI4WCQ Discovery agent N.A. Investigative [37]
2-Hydroxymethyl-3-hydroxymorphinan DM4LMPD Discovery agent N.A. Investigative [37]
3,6-bis(Dmt-Tic-NH-butyl)-2(1H)-pyrazinone DMWTP7Y Discovery agent N.A. Investigative [31]
3,6-bis(Dmt-Tic-NH-ethyl)-2(1H)-pyrazinone DM2Y4A6 Discovery agent N.A. Investigative [31]
3,6-bis(Dmt-Tic-NH-methyl)-2(1H)-pyrazinone DMJR983 Discovery agent N.A. Investigative [31]
3,6-bis(Dmt-Tic-NH-propyl)-2(1H)-pyrazinone DMEQBS3 Discovery agent N.A. Investigative [31]
3-desoxy-3-carboxamidonaltrexone DMBNA0V Discovery agent N.A. Investigative [39]
3-Methylfentanyl DMX71N9 Discovery agent N.A. Investigative [40]
3-Methylthiofentanyl DMC153X Discovery agent N.A. Investigative [41]
4-(4-((phenethylamino)methyl)phenoxy)benzamide DM0QRJ3 Discovery agent N.A. Investigative [42]
4-(p-Tolyl)spiro[chromene-2,4'-piperidine] DMIOQJD Discovery agent N.A. Investigative [43]
4-(Spiro[chromene-2,4'-piperidine]-4-yl)benzamide DM0XDG6 Discovery agent N.A. Investigative [44]
4-(Spiro[chromene-2,4'-piperidine]-4-yl)phenol DM8ZRAE Discovery agent N.A. Investigative [43]
4-phenyl-1-(1-phenylbutyl)piperidin-4-ol DMVCIJB Discovery agent N.A. Investigative [32]
4-phenyl-1-(1-phenylheptyl)piperidin-4-ol DMISTXQ Discovery agent N.A. Investigative [32]
4-phenyl-1-(1-phenylhexyl)piperidin-4-ol DM1GRWY Discovery agent N.A. Investigative [32]
4-phenyl-1-(1-phenylpentyl)piperidin-4-ol DMZQ7DP Discovery agent N.A. Investigative [32]
4-phenyl-1-(phenyl(m-tolyl)methyl)piperidin-4-ol DMFV0JC Discovery agent N.A. Investigative [32]
4-phenyl-1-(phenyl(o-tolyl)methyl)piperidin-4-ol DM2MPWC Discovery agent N.A. Investigative [32]
4-phenyl-1-(phenyl(p-tolyl)methyl)piperidin-4-ol DM5R6T4 Discovery agent N.A. Investigative [32]
4-phenyl-4-[1H-imidazol-2-yl]-piperidine DMPY4G1 Discovery agent N.A. Investigative [45]
4-Phenylspiro[chromene-2,4'-piperidine] DMW46K7 Discovery agent N.A. Investigative [43]
5-(4-((phenethylamino)methyl)phenoxy)picolinamide DMZYE8W Discovery agent N.A. Investigative [42]
6-(2-phenethylisoindolin-5-yloxy)nicotinamide DMQOJBN Discovery agent N.A. Investigative [46]
6-(4-((benzylamino)methyl)phenoxy)nicotinamide DMEM1BA Discovery agent N.A. Investigative [42]
6-(4-((phenethylamino)methyl)phenoxy)nicotinamide DM9VD4W Discovery agent N.A. Investigative [46]
6-(4-(2-(benzylamino)ethyl)phenoxy)nicotinamide DMDKOWP Discovery agent N.A. Investigative [46]
6-(4-(3-(benzylamino)propyl)phenoxy)nicotinamide DMDTMB7 Discovery agent N.A. Investigative [42]
6-(Allyl-methyl-amino)-4,4-diphenyl-heptan-3-ol DMYMJHF Discovery agent N.A. Investigative [47]
6-cinnamoyl-N-methylstephasunoline DMPXS9F Discovery agent N.A. Investigative [48]
6-cinnamoylhernandine DMPULH3 Discovery agent N.A. Investigative [48]
6-desoxonaltrexone DMGZQNS Discovery agent N.A. Investigative [39]
6beta-naltrexol HCl DMZ8PBE Discovery agent N.A. Investigative [49]
7-benzylidenenaltrexone DMCJED6 Discovery agent N.A. Investigative [50]
8-azabicyclo[3.2.1]octan-3-yloxy-benzamide DMQMSZR Discovery agent N.A. Investigative [51]
8-carboxamidocyclazocine DMD18V5 Discovery agent N.A. Investigative [52]
AKNADILACTAM DM4E6H1 Discovery agent N.A. Investigative [48]
AMINOFENTANYL DM7Y6AL Discovery agent N.A. Investigative [53]
ANALOG OF DYNORPHIN A DMYW5JX Discovery agent N.A. Investigative [16]
Antanal 1 DMGDZ6Q Discovery agent N.A. Investigative [54]
Antanal 2 DMZSUHY Discovery agent N.A. Investigative [54]
ARD-412 DM03E28 Premature ejaculation HA03.0Z Investigative [6]
BBI-11008 DMMUIQ6 Pain MG30-MG3Z Investigative [6]
Benzyl derivative of M6G DMX8W4G Discovery agent N.A. Investigative [55]
Beta-endorphin DM7XC6B Discovery agent N.A. Investigative [56]
Bis-((-)-N-propargylmorphinan-3-yl) sebacoylate DM0WKNI Discovery agent N.A. Investigative [27]
BUTORPHAN DM82KPQ Discovery agent N.A. Investigative [57]
CARBOXYFENTANYL DMI7Q61 Discovery agent N.A. Investigative [58]
Cis-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH DMQUB19 Discovery agent N.A. Investigative [59]
Clocinnamox DMZLMJH Discovery agent N.A. Investigative [36]
CTAP DMLON9K Discovery agent N.A. Investigative [6]
CTOP DM7VAJX Discovery agent N.A. Investigative [54]
CYCLAZOCINE DMC6DAZ Discovery agent N.A. Investigative [60]
CYCLORPHAN DMB1U8V Discovery agent N.A. Investigative [37]
C[L-mTyr-D-pro-L-Phe-D-trp] DMNHSR0 Discovery agent N.A. Investigative [61]
C[L-Phe-D-pro-L-mTyr-D-trp] DM82ZOM Discovery agent N.A. Investigative [61]
C[L-Phe-D-pro-L-Phe-L-trp] DMCY4L0 Discovery agent N.A. Investigative [61]
D-Phe-Cys-Tyr-D-Trp-Arg-Thr-Pen-Thr-NH2(CTAP) DM2EFLA Discovery agent N.A. Investigative [62]
D-Phe-Cys-Tyr-D-Trp-Lys-Thr-Pen-Thr-NH2(CTP) DMPQHRC Discovery agent N.A. Investigative [62]
D-Phe-Cys-Tyr-D-Trp-Orn-Thr-Pen-Thr-NH2(CTOP) DMX1IYO Discovery agent N.A. Investigative [62]
D-PhGly-Cys-Tyr-D-Trp-Lys-Thr-Pen-Thr-NH2 DMMXA5K Discovery agent N.A. Investigative [62]
DADLE DMRM0OW Discovery agent N.A. Investigative [63]
DAMGO DMS1DVA Discovery agent N.A. Investigative [64]
Dcp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2 DMU287Q Discovery agent N.A. Investigative [65]
DELTORPHIN DMHOT9P Discovery agent N.A. Investigative [66]
DELTORPHIN-II DM9ZWRK Discovery agent N.A. Investigative [67]
Deprotected cogener of M6G DMH340E Discovery agent N.A. Investigative [55]
DERMORPHIN DMCYQHO Discovery agent N.A. Investigative [68]
Dhp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2 DMSN87T Discovery agent N.A. Investigative [65]
Dihydromorphine DM4TR0D Discovery agent N.A. Investigative [69]
Dimepheptanol DMRMHE8 Discovery agent N.A. Investigative [47]
Dimethylthiambutene DM7EKAF Discovery agent N.A. Investigative [70]
Diprenorphine DMIXPU6 Discovery agent N.A. Investigative [71]
Dmt-Pro-3,5Dmp-Phe-NH2 DM5WEFK Discovery agent N.A. Investigative [72]
Dmt-Pro-Dmp-Phe-NH2 DMGUIR1 Discovery agent N.A. Investigative [72]
Dmt-Pro-Dmt-Phe-NH2 DM4VEU2 Discovery agent N.A. Investigative [72]
Dmt-Pro-Emp-Phe-NH2 DM06VGY Discovery agent N.A. Investigative [72]
Dmt-Pro-Imp-Phe-NH2 DMXUI1J Discovery agent N.A. Investigative [72]
Dmt-Pro-Mmp-Phe-NH2 DM78PFN Discovery agent N.A. Investigative [72]
Dmt-Pro-Phe-D-1-Nal-NH2 DM0VCWA Discovery agent N.A. Investigative [73]
Dmt-Pro-Phe-D-2-Nal-NH2 DMRJVE8 Discovery agent N.A. Investigative [73]
Dmt-Pro-Phe-Phe-NH2 DMM8BIE Discovery agent N.A. Investigative [72]
Dmt-Pro-Tmp-Phe-NH2 DMEMQAK Discovery agent N.A. Investigative [72]
Dmt-Pro-Trp-D-2-Nal-NH2 DMKEV5U Discovery agent N.A. Investigative [73]
DPDPE DMIRSNA Discovery agent N.A. Investigative [64]
DPI-221 DME5S3C Urinary incontinence MF50.2 Investigative [6]
DSLET DMSTOB0 Discovery agent N.A. Investigative [6]
DSTBULET DMSVP1K Discovery agent N.A. Investigative [74]
dynorphin B DMSPVLM Discovery agent N.A. Investigative [6]
ELAEOCARPENINE DMRHSCQ Discovery agent N.A. Investigative [75]
ENDOMORPHIN 2 DMOQWBU Discovery agent N.A. Investigative [76]
ENDOMORPHIN-1 DMBJUEM Discovery agent N.A. Investigative [77]
ethyketazocine DM7390Y Discovery agent N.A. Investigative [78]
ethylketocyclazocine DM9YRCU Discovery agent N.A. Investigative [6]
ETONITAZENE DMFR1SE Discovery agent N.A. Investigative [79]
Etorphine DM79YZN Discovery agent N.A. Investigative [80]
FALCARINDIOL DMLOV18 Discovery agent N.A. Investigative [81]
Grandisine C DMVLQUP Discovery agent N.A. Investigative [29]
Grandisine D DM0JHYF Discovery agent N.A. Investigative [29]
Grandisine F DM04S2P Discovery agent N.A. Investigative [29]
H-2',6'-dimethyltyrosine-Tic-OH DMYOADQ N. A. N. A. Investigative [82]
H-2',6'-dimethyltyrosine-Tic-Phe-Phe-OH DM7IEU2 Discovery agent N.A. Investigative [82]
H-Aba-ala-Gly-Phe-leu-OH DM61G0I Discovery agent N.A. Investigative [83]
H-Aba-ala-Gly-Phe-Met-OH DMKD94Q Discovery agent N.A. Investigative [83]
H-Aba-Gly-Gly-Phe-Leu-OH DMH1L3P Discovery agent N.A. Investigative [83]
H-Aba-ser-Gly-Phe-Leu-Thr-OH DMFE3J4 Discovery agent N.A. Investigative [83]
H-Apa-ala-Gly-Phe-leu-OH DM5SUYP Discovery agent N.A. Investigative [83]
H-Cdp-ala-Gly-Phe-leu-OH DMV751G Discovery agent N.A. Investigative [83]
H-Cdp-Gly-Gly-Phe-Leu-OH DMVEB8C Discovery agent N.A. Investigative [83]
H-Cdp-ser-Gly-Phe-Leu-Thr-OH DMCDLTV Discovery agent N.A. Investigative [83]
H-Cpa-c[pen-Gly-Phe-pen]OH DM3V4XG Discovery agent N.A. Investigative [83]
H-Cpa-Gly-Gly-Phe-Met-NH2 DMU6PV8 Discovery agent N.A. Investigative [83]
H-Cpa-Gly-Gly-Phe-Met-OH DM154G2 Discovery agent N.A. Investigative [83]
H-Cxp-ala-Gly-Phe-leu-OH DMPL0BR Discovery agent N.A. Investigative [83]
H-D-Tca-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2 DMY4QE6 Discovery agent N.A. Investigative [84]
H-D-Tic-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2 DM8GC36 Discovery agent N.A. Investigative [84]
H-D-Trp-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2 DMNAE6J Discovery agent N.A. Investigative [84]
H-Dmt-Aba-Gly-NH-CH2-Bid DM9WJZK Discovery agent N.A. Investigative [85]
H-Dmt-Aba-Gly-NH-CH2-Ph DM61CMS Discovery agent N.A. Investigative [85]
H-Dmt-Aba-Gly-NH-Ph DMCQYIJ Discovery agent N.A. Investigative [85]
H-Dmt-D-Arg(NO2)-Phe-Lys(Z)-NH2 DMHK70B Discovery agent N.A. Investigative [86]
H-Dmt-D-Arg(NO2)-Phe-Lys(Z)-OH DMM9EPQ Discovery agent N.A. Investigative [86]
H-Dmt-Tic-(2R,3R)-beta-MeCha-Phe-NH2 DM1ZDJ6 Discovery agent N.A. Investigative [87]
H-Dmt-Tic-(2R,3R)-beta-MeCha-Phe-OH DMC3APN Discovery agent N.A. Investigative [87]
H-Dmt-Tic-(2R,3S)-beta-MeCha-Phe-NH2 DMY97TN Discovery agent N.A. Investigative [87]
H-Dmt-Tic-(2R,3S)-beta-MeCha-Phe-OH DMGPAM0 Discovery agent N.A. Investigative [87]
H-Dmt-Tic-(2S,3R)-beta-MeCha-Phe-NH2 DMOI1U5 Discovery agent N.A. Investigative [87]
H-Dmt-Tic-(2S,3R)-beta-MeCha-Phe-OH DMZBFJ5 Discovery agent N.A. Investigative [87]
H-Dmt-Tic-(2S,3S)-beta-MeCha-Phe-NH2 DMNS1GX Discovery agent N.A. Investigative [87]
H-Dmt-Tic-(2S,3S)-beta-MeCha-Phe-OH DMM9TUR Discovery agent N.A. Investigative [87]
H-Dmt-Tic-Asp-N(Me)-Ph DM4JP8L Discovery agent N.A. Investigative [88]
H-Dmt-Tic-Asp-NH-Bzl DMBKOJG Discovery agent N.A. Investigative [88]
H-Dmt-Tic-Asp-NH-Ph DM3W9FQ Discovery agent N.A. Investigative [88]
H-Dmt-Tic-D-Asp-N(Me)-Ph DM483BG Discovery agent N.A. Investigative [88]
H-Dmt-Tic-D-Asp-NH-Ph DMUG7X1 Discovery agent N.A. Investigative [88]
H-Dmt-Tic-Glu-Dap(6DMN)-NH(2) DMQSRPD Discovery agent N.A. Investigative [30]
H-Dmt-Tic-Glu-NH-(CH2)5-NH2 DMF52SH Discovery agent N.A. Investigative [89]
H-Dmt-Tic-Glu-NH2 DM8A573 Discovery agent N.A. Investigative [89]
H-Dmt-Tic-Gly-N(Me)-Ph DMHYKBC Discovery agent N.A. Investigative [88]
H-Dmt-Tic-Gly-NH-Bzl DMM39YW Discovery agent N.A. Investigative [88]
H-Dmt-Tic-Gly-NH-CH2-Bid DMH6JOU Discovery agent N.A. Investigative [85]
H-Dmt-Tic-Gly-NH-Ph DMIZ28H Discovery agent N.A. Investigative [88]
H-Dmt-Tic-Lys(Ac)-NH-CH2-Ph DM2TY43 Discovery agent N.A. Investigative [90]
H-Dmt-Tic-Lys(Ac)-NH-Ph DMZH9P5 Discovery agent N.A. Investigative [90]
H-Dmt-Tic-Lys(Z)-NH-CH2-Ph DMP8HFA Discovery agent N.A. Investigative [90]
H-Dmt-Tic-Lys(Z)-NH-Ph DMBXGLA Discovery agent N.A. Investigative [90]
H-Dmt-Tic-Lys-NH-CH2-Ph DMDJ9PE Discovery agent N.A. Investigative [90]
H-Dmt-Tic-Lys-NH-Ph DMT3Y6E Discovery agent N.A. Investigative [90]
H-Dmt-Tic-NH-(CH2)6-NH-Dmt-H DMMJ9YN Discovery agent N.A. Investigative [91]
H-Dmt-Tic-NH-(CH2)6-NH-Phe-H DM0BGNE Discovery agent N.A. Investigative [91]
H-Dmt-Tic-NH-(CH2)6-NH-Tic-H DMQ586T Discovery agent N.A. Investigative [91]
H-Dmt-Tic-NH-(D)-CH[(CH2)4-NH-Z]-Bid DMAU2H6 Discovery agent N.A. Investigative [90]
H-Dmt-Tic-NH-(R)CH(CH2-COOH)-Bid DM5TZ1J Discovery agent N.A. Investigative [88]
H-Dmt-Tic-NH-(R)CH(CH2-COOH)-Bid(N1-Me) DMIDLPT Discovery agent N.A. Investigative [88]
H-Dmt-Tic-NH-(S)CH(CH2-COOH)-Bid(N1-Me) DMNEAQ9 Discovery agent N.A. Investigative [88]
H-Dmt-Tic-NH-CH2-Boa DM4IUCW Discovery agent N.A. Investigative [92]
H-Dmt-Tic-NH-CH2-Bta DMZ8C0U Discovery agent N.A. Investigative [92]
H-Dmt-Tic-NH-CH2-CH2-NH2 DMYJAW4 Discovery agent N.A. Investigative [93]
H-Dmt-Tic-NH-CH2-Imid DMJ2F8M Discovery agent N.A. Investigative [92]
H-Dmt-Tic-NH-CH2-ImidPh DMKGIQJ Discovery agent N.A. Investigative [92]
H-Dmt-Tic-NH-CH2-Indl DMNY3A1 Discovery agent N.A. Investigative [92]
H-Dmt-Tic-NH-CH2-Indn DMZWUFK Discovery agent N.A. Investigative [92]
H-Dmt-Tic-NH-CH[(CH2)4-NH-Ac]-Bid DM8PJ92 Discovery agent N.A. Investigative [90]
H-Dmt-Tic-NH-CH[(CH2)4-NH-Z]-Bid DMQ4ILK Discovery agent N.A. Investigative [90]
H-Dmt-Tic-NH-CH[(CH2)4-NH2]-Bid DMQEDP5 Discovery agent N.A. Investigative [90]
H-mCpa-ala-Gly-Phe-leu-OH DM17QMV Discovery agent N.A. Investigative [83]
H-mCpa-Gly-Gly-Phe-Leu-OH DMKAEQP Discovery agent N.A. Investigative [83]
H-mCpa-ser-Gly-Phe-Leu-Thr-OH DM8OUHV Discovery agent N.A. Investigative [83]
H-Poa-ser-Gly-Phe-Leu-Thr-OH DME1CT9 Discovery agent N.A. Investigative [83]
H-Tyr-c[cys-Gly-Phe(p-NO2)-cys]NH2 DMP8KMV Discovery agent N.A. Investigative [83]
H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]-OH DMA2CZL Discovery agent N.A. Investigative [59]
H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]NH2 DM48XV0 Discovery agent N.A. Investigative [94]
H-Tyr-c[D-Allylgly-Gly-Phe-L-Allylgly]NH2 DMXPJHB Discovery agent N.A. Investigative [94]
H-Tyr-c[D-Cys-Gly-Phe-D-Cys]NH2 DM7QAES Discovery agent N.A. Investigative [94]
H-Tyr-c[D-Cys-Gly-Phe-L-Cys]NH2 DMZSTL5 Discovery agent N.A. Investigative [94]
H-Tyr-c[D-Orn-(D or L)Atc-Glu]-NH2 DMI7CR9 Discovery agent N.A. Investigative [95]
H-Tyr-c[D-Orn-Aic-Glu]-NH2 DMOTI0P Discovery agent N.A. Investigative [95]
H-Tyr-c[pen-Gly-Phe-pen]OH DMAKPM1 Discovery agent N.A. Investigative [83]
H-Tyr-D-Ala-Gly Phe-Pro-Leu-Trp-O-3,5-Bzl(CF3)2 DMDF9AS Discovery agent N.A. Investigative [96]
H-Tyr-D-Ala-Gly-Phe-NH-NH-(NMe)Phe-Asp-Nle-Trp-Ac DM4VBDW Discovery agent N.A. Investigative [97]
H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Phe-D-Asp-D-Nle-Trp-H DM0J8P6 Discovery agent N.A. Investigative [98]
H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Trp-Nle-Asp-Phe-Bo DMW50ZQ Discovery agent N.A. Investigative [98]
H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Trp-Nle-Asp-Phe-H DMF82C1 Discovery agent N.A. Investigative [98]
H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-D-Trp-Boc DM6UWKL Discovery agent N.A. Investigative [97]
H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-D-Trp-H DMSXD63 Discovery agent N.A. Investigative [97]
H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-Trp-Ac DMRUD37 Discovery agent N.A. Investigative [97]
H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-Trp-Boc DMIPXCZ Discovery agent N.A. Investigative [97]
H-Tyr-D-Ala-Gly-Phe-NH-NH-Trp-D-Nle-D-Asp-D-Phe-H DMFSKDM Discovery agent N.A. Investigative [98]
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NH-3,5-Bzl(CF3)2 DM2K16M Discovery agent N.A. Investigative [96]
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NH-Bzl DMRE4ZI Discovery agent N.A. Investigative [96]
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NMe-3,5-Bzl(CF3)2 DM1ESMZ Discovery agent N.A. Investigative [96]
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NMe-Bzl DM56KDV Discovery agent N.A. Investigative [96]
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-O-Bzl DMH3YKR Discovery agent N.A. Investigative [96]
H-Tyr-Gly-Gly-Phe-Met-NH2 DM6D0ZS Discovery agent N.A. Investigative [83]
H-Tyr-NMe-D-Ala-Phe-Sar-NH2 DM1NT5G Discovery agent N.A. Investigative [99]
H-Tyr-Pro-Dap(6DMN)-Phe-NH2 DMQUNGC Discovery agent N.A. Investigative [30]
H-Tyr-Pro-Phe-Phe-NH-(CH2)5-(C=O)-Dap(6DMN)-NH2 DM326GJ Discovery agent N.A. Investigative [30]
H-Tyr-Pro-Phe-Phe-NH-CH2-CH2-NH Tic Dmt-H DMXQUKJ Discovery agent N.A. Investigative [93]
H-Tyr-Tic-Cha-Phe-OH DM1VFLG Discovery agent N.A. Investigative [87]
H-Tyr-Tic-OH DMIU52O Discovery agent N.A. Investigative [82]
H-Tyr-Tic-Phe-Phe-OH DMI0U87 Discovery agent N.A. Investigative [100]
HERKINORIN DMJXBWV Discovery agent N.A. Investigative [13]
HTyr-Gly-Gly-Phe-Leu-Arg-Arg-lle-Arg-Pro-LysNH2 DM25KZE Discovery agent N.A. Investigative [101]
ICI 154129 DMN6UET Discovery agent N.A. Investigative [102]
ICI-174864 DM1D6CQ Discovery agent N.A. Investigative [103]
ICI-199441 DMEWZ80 Discovery agent N.A. Investigative [104]
Isoelaeocarpine DMSLO71 Discovery agent N.A. Investigative [105]
Leucine-enkephalin DMT2CZK Discovery agent N.A. Investigative [106]
LOFENTANIL DMR2WQE Discovery agent N.A. Investigative [107]
LONGANINE DMH106Y Discovery agent N.A. Investigative [48]
Lophocladine a DM5OHVN Discovery agent N.A. Investigative [108]
M6G thiosaccharide analogue DMRB4YV Discovery agent N.A. Investigative [55]
MC-CAM DMAHN4L Discovery agent N.A. Investigative [109]
MCL-117 DMQIGZ7 Discovery agent N.A. Investigative [27]
MCL-139 DMQ1BDZ Discovery agent N.A. Investigative [27]
MCL-144 DMW7ZF8 Discovery agent N.A. Investigative [110]
MCL-145 DMJXU67 Discovery agent N.A. Investigative [27]
MCL-147 DMH5SMT Discovery agent N.A. Investigative [111]
MCL-149 DMTWY94 Discovery agent N.A. Investigative [111]
MCL-153 DMCPW5F Discovery agent N.A. Investigative [57]
MCL-154 DM3PIHV Discovery agent N.A. Investigative [57]
MCL-182 DM39YW1 Discovery agent N.A. Investigative [111]
MCL-183 DMVR51Z Discovery agent N.A. Investigative [111]
MCL-428 DMXBHE4 Discovery agent N.A. Investigative [112]
MCL-429 DM1XH04 Discovery agent N.A. Investigative [112]
MCL-431 DMISHCW Discovery agent N.A. Investigative [112]
MCL-432 DMPOFAR Discovery agent N.A. Investigative [112]
MCL-433 DMD3OAQ Discovery agent N.A. Investigative [112]
MCL-434 DMR31VO Discovery agent N.A. Investigative [112]
MCL-435 DMLSYD9 Discovery agent N.A. Investigative [112]
MCL-443 DM8LTQ4 Discovery agent N.A. Investigative [112]
MCL-444 DM8HALS Discovery agent N.A. Investigative [112]
MCL-445 DMR2K4F Discovery agent N.A. Investigative [111]
MCL-446 DMXF73G Discovery agent N.A. Investigative [111]
MCL-447 DMSTGNH Discovery agent N.A. Investigative [111]
MCL-448 DMSJGA9 Discovery agent N.A. Investigative [111]
MCL-449 DMQ890N Discovery agent N.A. Investigative [112]
MCL-450 DM7I6U8 Discovery agent N.A. Investigative [113]
MCL-451 DMP523A Discovery agent N.A. Investigative [113]
MCL-458 DMZN93Y Discovery agent N.A. Investigative [111]
MCP-203 DM0GLYB Major depressive disorder 6A70.3 Investigative [6]
MCP-204 DM0RZDF Bladder disease DC11-DC1Z Investigative [6]
MCP-205 DM3RYUZ Ischemic heart disease BA40-BA6Z Investigative [6]
METAZOCINE DMB6T23 Discovery agent N.A. Investigative [10]
N-(17-Methylmorphinan-3-yl)-N'-phenylurea DMFRQ2U Discovery agent N.A. Investigative [37]
N-(4-Iodophenyl)-N'-(17-methylmorphinan-3-yl)urea DMHANU5 Discovery agent N.A. Investigative [37]
N-alpha-amidino-Tyr(Me)-Pro-Trp-p-Cl-Phe-NH2 DM8QTSU Discovery agent N.A. Investigative [114]
N-alpha-amidino-Tyr(Me)-Pro-Trp-Phe-NH2 DMSC9FV Discovery agent N.A. Investigative [114]
N-Benzyl-17-(cyclobutylmethyl)morphinan-3-amine DM7SEM1 Discovery agent N.A. Investigative [37]
N-Benzyl-17-(cyclopropylmethyl)morphinan-3-amine DMLP9VM Discovery agent N.A. Investigative [37]
N-methylstephisoferulin DMZYSM1 Discovery agent N.A. Investigative [48]
N-methylstephuline DM5CR2E Discovery agent N.A. Investigative [48]
Naltrexone-6-alpha-ol DMRAN5O Discovery agent N.A. Investigative [10]
naltriben DMNDOLZ Discovery agent N.A. Investigative [115]
NORBINALTORPHIMINE DMLYZOG Discovery agent N.A. Investigative [116]
normorphine DMYQGFJ Discovery agent N.A. Investigative [6]
NRP290 DMC9XJA Pain MG30-MG3Z Investigative [6]
O-DESMETHYL TRAMADOL DM8ZG2I Discovery agent N.A. Investigative [10]
OXYMORPHINDOLE DMTP4S2 Discovery agent N.A. Investigative [117]
PERIPENTADENINE DMN9W56 Discovery agent N.A. Investigative [118]
PHENAZOCINE DMCTVMI Discovery agent N.A. Investigative [10]
PROSTEPHABYSSINE DMI8SH2 Discovery agent N.A. Investigative [48]
quadazocine DM2Q6JY Discovery agent N.A. Investigative [6]
RTI-5989-23 DMR4TM1 Discovery agent N.A. Investigative [20]
RTI-5989-25 DMQ28L9 Discovery agent N.A. Investigative [20]
RTI-5989-31 DMZO1QC Discovery agent N.A. Investigative [119]
SB 227122 DM7S63O Discovery agent N.A. Investigative [120]
SB-0304 DMOZX0D Discovery agent N.A. Investigative [99]
SN-11 DMA0JZM Discovery agent N.A. Investigative [24]
SN-23 DM6O0PD Discovery agent N.A. Investigative [24]
SN-28 DMB8TJC Discovery agent N.A. Investigative [121]
SNC-80 DMJI5H0 Discovery agent N.A. Investigative [122]
SOMATOSTATIN DMIOFQE Acromegaly 5A60.0 Investigative [62]
TIP DMZO1FJ Discovery agent N.A. Investigative [100]
TIPPpsi DM9FNQ6 Discovery agent N.A. Investigative [123]
Tonazocine mesylate DMROZL8 Discovery agent N.A. Investigative [124]
Trans-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH DMBU4KJ Discovery agent N.A. Investigative [59]
Tyr-(NMe)Ala-L-Phe-D-Pro-NH2 DMIWPKB Discovery agent N.A. Investigative [125]
Tyr-(R)-Aba-Gly-Phe-NH2 DMDQJUO Discovery agent N.A. Investigative [126]
Tyr-(S)-Aba-Gly-Phe-NH2 DMYZ792 Discovery agent N.A. Investigative [126]
Tyr-(S)-spiro-Aba-Gly-Phe-NH2 DMT316S Discovery agent N.A. Investigative [126]
Tyr-D-Ala-Gly-D-Trp-Nle-Asp-Phe-NH2 DM0D1Z5 Discovery agent N.A. Investigative [26]
Tyr-D-Ala-Gly-D-Trp-NMeNle-Asp-Phe-NH2 DMPH1G0 Discovery agent N.A. Investigative [26]
Tyr-D-Ala-Gly-Phe-Met-NH2 DMC7LND Discovery agent N.A. Investigative [22]
Tyr-D-Ala-Gly-Phe-Met-Pro-Leu-Trp-NH-Bzl DMWOP9N Discovery agent N.A. Investigative [127]
Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-NMeNle-D-Trp-Boc DMB2TCF Discovery agent N.A. Investigative [97]
Tyr-D-Ala-Gly-Trp-Nle-Asp-Phe-NH2 DMUXMVQ Discovery agent N.A. Investigative [26]
Tyr-D-Ala-Gly-Trp-NMeNle-Asp-Phe-NH2 DMREJ69 Discovery agent N.A. Investigative [26]
Tyr-D-Ala-Phe-Asp-Val-Val-Thr[Beta-D-Glc]-Gly-NH2 DMTPLNZ Discovery agent N.A. Investigative [128]
Tyr-D-Ala-Phe-Glu-Val-Val-Gly-NH2 DMC4NO5 Discovery agent N.A. Investigative [129]
Tyr-D-Ala-Phe-Gly-Tyr-Pro-Thr(Beta-D-Glc)-Gly-NH2 DM4FASR Discovery agent N.A. Investigative [128]
Tyr-D-Ala-Phe-Thr(-D-Glc)-Tyr-Pro-Ser-NH2 DMB9A46 Discovery agent N.A. Investigative [128]
Tyr-D-Met-Phe-His-Leu-Met-Asp-NH2 DM4YTFP Discovery agent N.A. Investigative [129]
Tyr-D-Nle-Gly-D-Trp-Nle-Asp-Phe-NH2 DMY9NIJ Discovery agent N.A. Investigative [26]
Tyr-D-Nle-Gly-D-Trp-NMeNle-Asp-Phe-NH2 DMQREP2 Discovery agent N.A. Investigative [26]
Tyr-D-Nle-Gly-Trp-Nle-Asp-Phe-NH2 DMZ24LN Discovery agent N.A. Investigative [26]
Tyr-D-Nle-Gly-Trp-NMeNle-Asp-Phe-NH2 DMPSJ72 Discovery agent N.A. Investigative [26]
Tyr-D-Phe-Gly-D-Trp-Nle-Asp-Phe-NH2 DMIWMN6 Discovery agent N.A. Investigative [26]
Tyr-D-Phe-Gly-D-Trp-NMeNle-Asp-Phe-NH2 DM2CEWT Discovery agent N.A. Investigative [26]
Tyr-D-Phe-Gly-Trp-Nle-Asp-Phe-NH2 DMKM81A Discovery agent N.A. Investigative [26]
Tyr-D-Phe-Gly-Trp-NMeNle-Asp-Phe-NH2 DMZOTGM Discovery agent N.A. Investigative [26]
Tyr-D-Pro-Gly-Trp-NMeNle-Asp-Phe-NH2 DMM9H07 Discovery agent N.A. Investigative [26]
Tyr-Gly-Gly-Phe-c(Cys-Arg-Arg-Ile-Cys)-Arg-lys DMKND2R Discovery agent N.A. Investigative [16]
Tyr-Gly-Gly-Phe-leu-c(Cys-Arg-Ile-Arg-Cys)-lys DMG6NDA Discovery agent N.A. Investigative [16]
Tyr-Gly-Gly-Trp-NMeNle-Asp-Phe-NH2 DMN7290 Discovery agent N.A. Investigative [26]
Tyr-Pro-3,5Dmp-Phe-NH2 DMDCJWU Discovery agent N.A. Investigative [72]
Tyr-Pro-D-Phe-D-Pro-NH2 DM4ZJR5 Discovery agent N.A. Investigative [125]
Tyr-Pro-D-Phe-Pro-NH2 DMCTSNE Discovery agent N.A. Investigative [125]
Tyr-Pro-D-Phg-Phe-NH2 DMEDVRN Discovery agent N.A. Investigative [130]
Tyr-Pro-Dmp-Phe-NH2 DMNXCHT Discovery agent N.A. Investigative [72]
Tyr-Pro-Dmt-Phe-NH2 DMOU43H Discovery agent N.A. Investigative [72]
Tyr-Pro-Emp-Phe-NH2 DMUKE43 Discovery agent N.A. Investigative [72]
Tyr-Pro-Gly-Trp-NMeNle-Asp-Phe-NH2 DM8THU2 Discovery agent N.A. Investigative [26]
Tyr-Pro-Imp-Phe-NH2 DMUV3ZW Discovery agent N.A. Investigative [72]
Tyr-Pro-L-(NMe)Phe-D-Pro-NH2 DMI65GV Discovery agent N.A. Investigative [125]
Tyr-Pro-L-(NMe)Phe-Pro-NH2 DM1NITL Discovery agent N.A. Investigative [125]
Tyr-Pro-L-Phe-D-Pro-NH2 DMUVHGS Discovery agent N.A. Investigative [125]
Tyr-Pro-L-Phe-Pro-NH2 DM8VW3Z Discovery agent N.A. Investigative [125]
Tyr-Pro-Mmp-Phe-NH DMRE7G3 Discovery agent N.A. Investigative [72]
Tyr-Pro-Phe-Phe-N(CH3)2 DM5DRIZ Discovery agent N.A. Investigative [131]
Tyr-Pro-Phe-Phe-NHCH3 DM2U4VI Discovery agent N.A. Investigative [131]
Tyr-Pro-Phe-Phe-NHNH2 DMY6V9R Discovery agent N.A. Investigative [131]
Tyr-Pro-Phe-Phe-OC(CH3)3 DMS4P1E Discovery agent N.A. Investigative [131]
Tyr-Pro-Phe-Phe-OCH2CH3 DMZNHEC Discovery agent N.A. Investigative [131]
Tyr-Pro-Phe-Phe-OCH2OH DMFV7NI Discovery agent N.A. Investigative [131]
Tyr-Pro-Phe-Phe-OCH3 DMRQXHO Discovery agent N.A. Investigative [131]
Tyr-Pro-Tmp-Phe-NH DMR3IVB Discovery agent N.A. Investigative [72]
UFP-502 DMD8BRG Discovery agent N.A. Investigative [67]
UFP-512 DMYPVSJ Discovery agent N.A. Investigative [67]
[3H]diprenorphine DMBMS1U Discovery agent N.A. Investigative [6]
[3H]naltrindole DMQW3A9 Discovery agent N.A. Investigative [132]
[Dcp1]Dyn A(1-11)-NH2 DM23GCK Discovery agent N.A. Investigative [65]
[Leu5]enkephalin DMA0N32 Discovery agent N.A. Investigative [133]
------------------------------------------------------------------------------------
⏷ Show the Full List of 373 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Rheumatoid arthritis FA20 Synovial tissue 1.85E-03 -0.85 -2.06
Major depressive disorder 6A20 Pre-frontal cortex 5.52E-01 0.03 0.23
------------------------------------------------------------------------------------

References

1 Oxycodone: a pharmacological and clinical review. Clin Transl Oncol. 2007 May;9(5):298-307.
2 Butorphanol: effects of a prototypical agonist-antagonist analgesic on kappa-opioid receptors. J Pharmacol Sci. 2005 Jun;98(2):109-16.
3 Molecular characterization of eluxadoline as a potential ligand targeting mu-delta opioid receptor heteromers.Biochem Pharmacol.2014 Dec 1;92(3):448-56.
4 Identification of opioid ligands possessing mixed micro agonist/delta antagonist activity among pyridomorphinans derived from naloxone, oxymorphone, and hydromorphone [correction of hydropmorphone]. J Med Chem. 2004 Mar 11;47(6):1400-12.
5 Loperamide: evidence of interaction with mu and delta opioid receptors. Life Sci. 1983;33 Suppl 1:315-8.
6 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 317).
7 Preclinical pharmacology of AZD2327: a highly selective agonist of the delta-opioid receptor. J Pharmacol Exp Ther. 2011 Jul;338(1):195-204.
8 Wax PM, Becker CE, Curry SC: Unexpected gas casualties in Moscow: a medical toxicology perspective. Ann Emerg Med. 2003 May;41(5):700-5.
9 Delta-opioid receptor agonists inhibit neuromuscular transmission in human colon. Eur J Pharmacol. 1994 Sep 1;262(1-2):33-9.
10 Syntheses and opioid receptor binding properties of carboxamido-substituted opioids. Bioorg Med Chem Lett. 2009 Jan 1;19(1):203-8.
11 US patent application no. 6,924,288, Enantiomerically pure opioid diarylmethylpiperzine and methods of using same.
12 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018026)
13 Herkinorin analogues with differential beta-arrestin-2 interactions. J Med Chem. 2008 Apr 24;51(8):2421-31.
14 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
15 DPI-3290 [(+)-3-((alpha-R)-alpha-((2S,5R)-4-Allyl-2,5-dimethyl-1-piperazinyl)-3-hydroxybenzyl)-N-(3-fluorophenyl)-N-methylbenzamide]. II. A mixed opioid agonist with potent antinociceptive activity and limited effects on respiratory function. J Pharmacol Exp Ther. 2003 Dec;307(3):1227-33.
16 Design and synthesis of highly potent and selective cyclic dynorphin A analogs. 2. New analogs. J Med Chem. 1993 Mar 19;36(6):750-7.
17 Design and synthesis of a metabolically stable and potent antitussive agent, a novel delta opioid receptor antagonist, TRK-851. Bioorg Med Chem. 2008 Sep 1;16(17):7956-67.
18 WO patent application no. 2007,0677,14, Treatment of sequelae of psychiatric disorders.
19 Pharmacologic therapeutics for cardiac reperfusion injury. Expert Opin Emerg Drugs. 2007 Sep;12(3):367-88.
20 Investigation of the N-substituent conformation governing potency and mu receptor subtype-selectivity in (+)-(3R, 4R)-dimethyl-4-(3-hydroxyphenyl)p... J Med Chem. 1998 May 21;41(11):1980-90.
21 In vivo pharmacological characterization of SoRI 9409, a nonpeptidic opioid mu-agonist/delta-antagonist that produces limited antinociceptive tolerance and attenuates morphine physical dependence. J Pharmacol Exp Ther. 2001 May;297(2):597-605.
22 The biological activity and metabolic stability of peptidic bifunctional compounds that are opioid receptor agonists and neurokinin-1 receptor anta... Bioorg Med Chem. 2009 Oct 15;17(20):7337-43.
23 BW373U86, a delta opioid agonist, partially mediates delayed cardioprotection via a free radical mechanism that is independent of opioid receptor stimulation. J Mol Cell Cardiol. 2001 Aug;33(8):1455-65.
24 Design and synthesis of novel delta opioid receptor agonists and their pharmacologies. Bioorg Med Chem Lett. 2009 May 15;19(10):2792-5.
25 Mutation W284L of the human delta opioid receptor reveals agonist specific receptor conformations for G protein activation. Life Sci. 2001 Apr 6;68(19-20):2233-42.
26 Structure-activity relationships of bifunctional peptides based on overlapping pharmacophores at opioid and cholecystokinin receptors. J Med Chem. 2006 May 18;49(10):2868-75.
27 Synthesis and preliminary in vitro investigation of bivalent ligands containing homo- and heterodimeric pharmacophores at mu, delta, and kappa opio... J Med Chem. 2006 Jan 12;49(1):256-62.
28 Akuammine and dihydroakuammine, two indolomonoterpene alkaloids displaying affinity for opioid receptors. J Nat Prod. 1992 Mar;55(3):380-4.
29 Grandisines C-G, indolizidine alkaloids from the Australian rainforest tree Elaeocarpus grandis. J Nat Prod. 2006 Sep;69(9):1295-9.
30 6-N,N-dimethylamino-2,3-naphthalimide: a new environment-sensitive fluorescent probe in delta- and mu-selective opioid peptides. J Med Chem. 2006 Jun 15;49(12):3653-8.
31 Potent Dmt-Tic pharmacophoric delta- and mu-opioid receptor antagonists. J Med Chem. 2005 Dec 15;48(25):8035-44.
32 Bioorg Med Chem Lett. 2007 Jun 1;17(11):3023-7. Epub 2007 Mar 23.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 1.
33 Bioorg Med Chem Lett. 2007 Jun 1;17(11):3028-33. Epub 2007 Mar 21.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 2.
34 The discovery of tropane derivatives as nociceptin receptor ligands for the management of cough and anxiety. Bioorg Med Chem Lett. 2009 May 1;19(9):2519-23.
35 Discovery of novel triazole-based opioid receptor antagonists. J Med Chem. 2006 Jul 13;49(14):4044-7.
36 14 beta-O-cinnamoylnaltrexone and related dihydrocodeinones are mu opioid receptor partial agonists with predominant antagonist activity. J Med Chem. 2009 Mar 26;52(6):1553-7.
37 Synthesis and opioid receptor binding affinities of 2-substituted and 3-aminomorphinans: ligands for mu, kappa, and delta opioid receptors. J Med Chem. 2010 Jan 14;53(1):402-18.
38 Structural determinants of opioid activity in derivatives of 14-aminomorphinones: effect of substitution in the aromatic ring of cinnamoylaminomorp... J Med Chem. 2006 Aug 24;49(17):5333-8.
39 Syntheses of novel high affinity ligands for opioid receptors. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2289-94.
40 Subramanian G, Paterlini MG, Portoghese PS, Ferguson DM: Molecular docking reveals a novel binding site model for fentanyl at the mu-opioid receptor. J Med Chem. 2000 Feb 10;43(3):381-91.
41 You HJ, Colpaert FC, Arendt-Nielsen L: The novel analgesic and high-efficacy 5-HT1A receptor agonist F 13640 inhibits nociceptive responses, wind-up, and after-discharges in spinal neurons and withdrawal reflexes. Exp Neurol. 2005 Jan;191(1):174-83.
42 Structure-activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 1. Bioorg Med Chem Lett. 2007 Oct 1;17(19):5349-52.
43 Potent, orally bioavailable delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-4-(5-hydroxyspiro[chromene-2,4'-pipe... J Med Chem. 2008 Oct 9;51(19):5893-6.
44 Spirocyclic delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-3-hydroxy-4-(spiro[chromene-2,4'-piperidine]-4-yl) b... J Med Chem. 2009 Sep 24;52(18):5685-702.
45 4-Phenyl-4-[1H-imidazol-2-yl]-piperidine derivatives, a novel class of selective delta-opioid agonists. Bioorg Med Chem Lett. 2006 Jan 1;16(1):146-9.
46 Structure activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 2. Bioorg Med Chem Lett. 2007 Dec 15;17(24):6841-6.
47 Synthesis of analogues of acetylmethadol and methadol as potential narcotic antagonists. J Med Chem. 1981 Jul;24(7):903-6.
48 Hasubanan alkaloids with delta-opioid binding affinity from the aerial parts of Stephania japonica. J Nat Prod. 2010 May 28;73(5):988-91.
49 Design, synthesis, and characterization of 6beta-naltrexol analogs, and their selectivity for in vitro opioid receptor subtypes. Bioorg Med Chem Lett. 2009 May 15;19(10):2811-4.
50 Delta-opioid receptor antagonists as a new concept for central acting antitussive drugs. Pulm Pharmacol Ther. 2002;15(3):235-40.
51 SAR development of a series of 8-azabicyclo[3.2.1]octan-3-yloxy-benzamides as kappa opioid receptor antagonists. Part 2. Bioorg Med Chem Lett. 2010 Sep 15;20(18):5405-10.
52 Redefining the structure-activity relationships of 2,6-methano-3-benzazocines. Part 6: Opioid receptor binding properties of cyclic variants of 8-c... Bioorg Med Chem. 2008 May 15;16(10):5653-64.
53 Synthesis and evaluation of 3-aminopropionyl substituted fentanyl analogues for opioid activity. Bioorg Med Chem Lett. 2006 Sep 15;16(18):4946-50.
54 Novel opioid peptide derived antagonists containing (2S)-2-methyl-3-(2,6-dimethyl-4-carbamoylphenyl)propanoic acid [(2S)-Mdcp]. J Med Chem. 2008 Sep 25;51(18):5866-70.
55 Synthesis and in vitro biological evaluation of a carbon glycoside analogue of morphine-6-glucuronide. Bioorg Med Chem Lett. 2005 Mar 15;15(6):1583-6.
56 Cross-linking of human [125I]beta-endorphin to opioid receptors in rat striatal membranes: biochemical evidence for the existence of a mu/delta opioid receptor complex. J Pharmacol Exp Ther. 1990 Apr;253(1):419-26.
57 Effect of linker substitution on the binding of butorphan univalent and bivalent ligands to opioid receptors. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1507-9.
58 Development of novel enkephalin analogues that have enhanced opioid activities at both mu and delta opioid receptors. J Med Chem. 2007 Nov 1;50(22):5528-32.
59 Synthesis of stable and potent delta/mu opioid peptides: analogues of H-Tyr-c[D-Cys-Gly-Phe-D-Cys]-OH by ring-closing metathesis. J Med Chem. 2007 Jun 28;50(13):3138-42.
60 Redefining the structure-activity relationships of 2,6-methano-3-benzazocines. Part 7: syntheses and opioid receptor properties of cyclic variants ... Bioorg Med Chem Lett. 2009 Jan 15;19(2):365-8.
61 Nascent structure-activity relationship study of a diastereomeric series of kappa opioid receptor antagonists derived from CJ-15,208. Bioorg Med Chem Lett. 2009 Jul 1;19(13):3647-50.
62 Design and synthesis of conformationally constrained somatostatin analogues with high potency and specificity for mu opioid receptors. J Med Chem. 1986 Nov;29(11):2370-5.
63 Delta opioid receptor stimulation mimics ischemic preconditioning in human heart muscle. J Am Coll Cardiol. 2000 Dec;36(7):2296-302.
64 Evaluation of N-substitution in 6,7-benzomorphan compounds. Bioorg Med Chem. 2010 Jul 15;18(14):4975-82.
65 Replacement of the N-terminal tyrosine residue in opioid peptides with 3-(2,6-dimethyl-4-carbamoylphenyl)propanoic acid (Dcp) results in novel opio... J Med Chem. 2006 Aug 24;49(17):5382-5.
66 Cyclic enkephalin analogs with exceptional potency at peripheral delta opioid receptors. J Med Chem. 1994 Jan 7;37(1):146-50.
67 Role of 2',6'-dimethyl-l-tyrosine (Dmt) in some opioid lead compounds. Bioorg Med Chem. 2010 Aug 15;18(16):6024-30.
68 Conversion of the potent delta-opioid agonist H-Dmt-Tic-NH-CH(2)-bid into delta-opioid antagonists by N(1)-benzimidazole alkylation(1). J Med Chem. 2005 Dec 29;48(26):8112-4.
69 Opiate receptor binding properties of morphine-, dihydromorphine-, and codeine 6-O-sulfate ester congeners. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4291-5.
70 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
71 [6-O-methyl-11C]Diprenorphine Molecular Imaging and Contrast Agent Database (MICAD) [Internet].
72 Bifunctional [2',6'-dimethyl-L-tyrosine1]endomorphin-2 analogues substituted at position 3 with alkylated phenylalanine derivatives yield potent mi... J Med Chem. 2007 Jun 14;50(12):2753-66.
73 Synthesis and characterization of potent and selective mu-opioid receptor antagonists, [Dmt(1), D-2-Nal(4)]endomorphin-1 (Antanal-1) and [Dmt(1), D... J Med Chem. 2007 Feb 8;50(3):512-20.
74 [3H][D-Ser2(O-tert-butyl),Leu5]enkephalyl-Thr6 and [D-Ser2(O-tert-butyl),Leu5]enkephalyl-Thr6(O-tert-butyl). Two new enkephalin analogs with both a good selectivity and a high affinity toward delta-opioid binding sites. J Biol Chem. 1988 Mar 25;263(9):4124-30.
75 Synthesis and evaluation of opioid receptor-binding affinity of elaeocarpenine and its analogs. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1601-3.
76 Synthesis and activity of endomorphin-2 and morphiceptin analogues with proline surrogates in position 2. Eur J Med Chem. 2010 Oct;45(10):4594-600.
77 New endomorphin analogues containing alicyclic beta-amino acids: influence on bioactive conformation and pharmacological profile. J Med Chem. 2008 Jul 24;51(14):4270-9.
78 Cloning and functional comparison of kappa and delta opioid receptors from mouse brain. Proc Natl Acad Sci U S A. 1993 Jul 15;90(14):6736-40.
79 Photoactivatable opiate derivatives as irreversible probes of the mu-opioid receptor. J Med Chem. 1990 Sep;33(9):2456-64.
80 Agonist-, antagonist-, and inverse agonist-regulated trafficking of the delta-opioid receptor correlates with, but does not require, G protein activation. J Pharmacol Exp Ther. 2001 Sep;298(3):1015-20.
81 Novel coumarin glycoside and phenethyl vanillate from Notopterygium forbesii and their binding affinities for opioid and dopamine receptors. Bioorg Med Chem. 2008 Mar 15;16(6):3218-23.
82 Agonist vs antagonist behavior of delta opioid peptides containing novel phenylalanine analogues in place of Tyr(1). J Med Chem. 2009 Nov 12;52(21):6941-5.
83 Further studies of tyrosine surrogates in opioid receptor peptide ligands. Bioorg Med Chem Lett. 2007 May 1;17(9):2656-60.
84 Opiate aromatic pharmacophore structure-activity relationships in CTAP analogues determined by topographical bias, two-dimensional NMR, and biologi... J Med Chem. 2000 Feb 24;43(4):569-80.
85 New 2',6'-dimethyl-L-tyrosine (Dmt) opioid peptidomimetics based on the Aba-Gly scaffold. Development of unique mu-opioid receptor ligands. J Med Chem. 2006 Jun 29;49(13):3990-3.
86 From the potent and selective mu opioid receptor agonist H-Dmt-d-Arg-Phe-Lys-NH(2) to the potent delta antagonist H-Dmt-Tic-Phe-Lys(Z)-OH. J Med Chem. 2005 Aug 25;48(17):5608-11.
87 Beta-methyl substitution of cyclohexylalanine in Dmt-Tic-Cha-Phe peptides results in highly potent delta opioid antagonists. J Med Chem. 2007 Jan 25;50(2):328-33.
88 Further studies on lead compounds containing the opioid pharmacophore Dmt-Tic. J Med Chem. 2008 Aug 28;51(16):5109-17.
89 Highly selective fluorescent analogue of the potent delta-opioid receptor antagonist Dmt-Tic. J Med Chem. 2004 Dec 16;47(26):6541-6.
90 Effect of lysine at C-terminus of the Dmt-Tic opioid pharmacophore. J Med Chem. 2006 Sep 7;49(18):5610-7.
91 New series of potent delta-opioid antagonists containing the H-Dmt-Tic-NH-hexyl-NH-R motif. Bioorg Med Chem Lett. 2005 Dec 15;15(24):5517-20.
92 Role of benzimidazole (Bid) in the delta-opioid agonist pseudopeptide H-Dmt-Tic-NH-CH(2)-Bid (UFP-502). Bioorg Med Chem. 2008 Mar 15;16(6):3032-8.
93 A new opioid designed multiple ligand derived from the micro opioid agonist endomorphin-2 and the delta opioid antagonist pharmacophore Dmt-Tic. Bioorg Med Chem. 2007 Nov 15;15(22):6876-81.
94 Dicarba analogues of the cyclic enkephalin peptides H-Tyr-c[D-Cys-Gly-Phe-D(or L)-Cys]NH(2) retain high opioid activity. J Med Chem. 2007 Mar 22;50(6):1414-7.
95 Conformational restriction of the phenylalanine residue in a cyclic opioid peptide analogue: effects on receptor selectivity and stereospecificity. J Med Chem. 1991 Oct;34(10):3125-32.
96 A structure-activity relationship study and combinatorial synthetic approach of C-terminal modified bifunctional peptides that are delta/mu opioid ... J Med Chem. 2008 Mar 13;51(5):1369-76.
97 Design and synthesis of novel hydrazide-linked bifunctional peptides as delta/mu opioid receptor agonists and CCK-1/CCK-2 receptor antagonists. J Med Chem. 2006 Mar 9;49(5):1773-80.
98 Partial retro-inverso, retro, and inverso modifications of hydrazide linked bifunctional peptides for opioid and cholecystokinin (CCK) receptors. J Med Chem. 2007 Jan 11;50(1):165-8.
99 Blood-brain barrier penetration by two dermorphin tetrapeptide analogues: role of lipophilicity vs structural flexibility. J Med Chem. 2008 Apr 24;51(8):2571-4.
100 The TIPP opioid peptide family: development of delta antagonists, delta agonists, and mixed mu agonist/delta antagonists. Biopolymers. 1999;51(6):411-25.
101 The effects of C-terminal modifications on the opioid activity of [N-benzylTyr(1)]dynorphin A-(1-11) analogues. J Med Chem. 2009 Nov 12;52(21):6814-21.
102 In vivo evidence for the selectivity of ICI 154129 for the delta-opioid receptor. Neuropharmacology. 1985 Feb;24(2):107-10.
103 Highly potent and selective phenylmorphan-based inverse agonists of the opioid delta receptor. J Med Chem. 2006 Sep 7;49(18):5597-609.
104 Arylacetamide kappa opioid receptor agonists with reduced cytochrome P450 2D6 inhibitory activity. Bioorg Med Chem Lett. 2005 May 16;15(10):2647-52.
105 Indolizidine alkaloids with delta-opioid receptor binding affinity from the leaves of Elaeocarpus fuscoides. J Nat Prod. 2007 May;70(5):872-5.
106 Inverse agonist action of Leu-enkephalin at delta(2)-opioid receptors mediates spinal antianalgesia. J Pharmacol Exp Ther. 2001 May;297(2):582-9.
107 Potential affinity labels for the opiate receptor based on fentanyl and related compounds. J Med Chem. 1982 Aug;25(8):913-9.
108 Lophocladines, bioactive alkaloids from the red alga Lophocladia sp. J Nat Prod. 2006 Apr;69(4):640-4.
109 14beta-Arylpropiolylamino-17-cyclopropylmethyl-7,8-dihydronormorphinones and related opioids. Further examples of pseudoirreversible mu opioid rece... J Med Chem. 2009 Nov 12;52(21):6926-30.
110 Univalent and bivalent ligands of butorphan: characteristics of the linking chain determine the affinity and potency of such opioid ligands. J Med Chem. 2009 Dec 10;52(23):7389-96.
111 In-vitro investigation of oxazol and urea analogues of morphinan at opioid receptors. Bioorg Med Chem. 2007 Jun 15;15(12):4106-12.
112 High-affinity carbamate analogues of morphinan at opioid receptors. Bioorg Med Chem Lett. 2007 Mar 15;17(6):1508-11.
113 New opioid designed multiple ligand from Dmt-Tic and morphinan pharmacophores. J Med Chem. 2006 Sep 7;49(18):5640-3.
114 Endomorphin-1 analogs with enhanced metabolic stability and systemic analgesic activity: design, synthesis, and pharmacological characterization. Bioorg Med Chem. 2007 Feb 15;15(4):1694-702.
115 Differential antagonism of delta opioid agonists by naltrindole and its benzofuran analog (NTB) in mice: evidence for delta opioid receptor subtypes. J Pharmacol Exp Ther. 1991 May;257(2):676-80.
116 Identification of (3R)-7-hydroxy-N-((1S)-1-[[(3R,4R)-4-(3-hydroxyphenyl)- 3,4-dimethyl-1-piperidinyl]methyl]-2-methylpropyl)-1,2,3,4-tetrahydro- 3-... J Med Chem. 2003 Jul 3;46(14):3127-37.
117 Ligand binding to nucleic acids and proteins: Does selectivity increase with strength Eur J Med Chem. 2008 Nov;43(11):2307-15.
118 Alkaloids with human delta-opioid receptor binding affinity from the Australian rainforest tree Peripentadenia mearsii. J Nat Prod. 2007 Dec;70(12):1946-50.
119 Probes for narcotic receptor mediated phenomena. 34. Synthesis and structure-activity relationships of a potent mu-agonist delta-antagonist and an ... J Med Chem. 2007 Aug 9;50(16):3765-76.
120 The antitussive activity of delta-opioid receptor stimulation in guinea pigs. J Pharmacol Exp Ther. 2000 Feb;292(2):803-9.
121 Design and synthesis of KNT-127, a -opioid receptor agonist effective by systemic administration. Bioorg Med Chem Lett. 2010 Nov 1;20(21):6302-5.
122 Nonpeptidic delta-opioid receptor agonists reduce immobility in the forced swim assay in rats. Neuropsychopharmacology. 2002 Jun;26(6):744-55.
123 TIPP[psi]: a highly potent and stable pseudopeptide delta opioid receptor antagonist with extraordinary delta selectivity. J Med Chem. 1993 Oct 15;36(21):3182-7.
124 Antiparkinson potential of delta-opioid receptor agonists. Eur J Pharmacol. 2000 May 19;396(2-3):101-7.
125 A topochemical approach to explain morphiceptin bioactivity. J Med Chem. 1993 Mar 19;36(6):708-19.
126 Endomorphin-2 with a beta-turn backbone constraint retains the potent micro-opioid receptor agonist properties. J Med Chem. 2008 Jan 10;51(1):173-7.
127 The importance of micelle-bound states for the bioactivities of bifunctional peptide derivatives for delta/mu opioid receptor agonists and neurokin... J Med Chem. 2008 Oct 23;51(20):6334-47.
128 Synthesis and pharmacological activity of deltorphin and dermorphin-related glycopeptides. J Med Chem. 1997 Aug 29;40(18):2948-52.
129 Design of cyclic deltorphins and dermenkephalins with a disulfide bridge leads to analogues with high selectivity for delta-opioid receptors. J Med Chem. 1994 Jan 7;37(1):141-5.
130 Opioid receptor binding and antinociceptive activity of the analogues of endomorphin-2 and morphiceptin with phenylalanine mimics in the position 3... Bioorg Med Chem Lett. 2006 Jul 15;16(14):3688-92.
131 Structure-activity study of endomorphin-2 analogs with C-terminal modifications by NMR spectroscopy and molecular modeling. Bioorg Med Chem. 2008 Jun 15;16(12):6415-22.
132 Characterization of [3H]naltrindole binding to delta opioid receptors in rat brain. Life Sci. 1992;50(16):PL119-24.
133 Carba-analogues of fentanyl are opioid receptor agonists. J Med Chem. 2010 Apr 8;53(7):2875-81.