Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT27RFC)

• DTT Name: Opioid receptor delta (OPRD1)
• Synonyms: OPRD; Delta-type opioid receptor; Delta opioid receptor; DOR-1; D-OR-1
• Gene Name: OPRD1
• DTT Type: Successful target; [1]
• Related Disease:
  Bowel habit change [ICD-11: ME05]
  Irritable bowel syndrome [ICD-11: DD91]
  Pain [ICD-11: MG30-MG3Z]
• BioChemical Class: GPCR rhodopsin
• UniProt ID: OPRD_HUMAN
• TTD ID: T58992
• Sequence:
  MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
  AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
  CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
  VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
  RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
  HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
  TPSDGPGGGAAA
• Function: Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain and in opiate-mediated analgesia. Plays a role in developing analgesic tolerance to morphine. G-protein coupled receptor that functions as receptor for endogenous enkephalins and for a subset of other opioids.
• KEGG Pathway:
  cGMP-PKG signaling pathway (hsa04022)
  Sphingolipid signaling pathway (hsa04071)
  Neuroactive ligand-receptor interaction (hsa04080)
• Reactome Pathway:
  G alpha (i) signalling events (R-HSA-418594)
  Peptide ligand-binding receptors (R-HSA-375276)

Molecular Interaction Atlas (MIA) of This DTT

6 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Butorphanol	DM5KYPJ	Pain	MG30-MG3Z	Approved	[2]
Codeine	DMJX6ZG	Pain	MG30-MG3Z	Approved	[2]
Eluxadoline	DMYZ0P1	Diarrhea-predominant irritable bowel syndrome	DD91.01	Approved	[3]
Hydromorphone	DMHP21E	Pain	MG30-MG3Z	Approved	[4]
Loperamide	DMOJZQ9	Diarrhea	ME05.1	Approved	[5]
Oxycodone	DMXLKHV	Pain	MG30-MG3Z	Approved	[1]

11 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ADL-5747	DMMUPTN	Pain	MG30-MG3Z	Phase 2	[6]
ADL-5859	DMDQH9A	Rheumatoid arthritis	FA20	Phase 2	[6]
AZD-2327	DM8FZOG	Anxiety disorder	6B00-6B0Z	Phase 2	[7]
Carfentanil	DM7ADGX	N. A.	N. A.	Phase 2	[8]
Met-enkephalin	DMSZFTP	Pain	MG30-MG3Z	Phase 2	[9], [10]
TPM-1/Morphine	DM4R23C	Pain	MG30-MG3Z	Phase 2	[11]
AIKO-150	DMW9ZFS	Opioid dependence	6C43.2Z	Phase 1	[12]
MCP-201	DMW9YOJ	Pain	MG30-MG3Z	Phase 1	[13]
MCP-202	DM65B7G	Overactive bladder	GC50.0	Phase 1	[14]
Salvinorin A	DMJ3HQY	Cerebral vasospasm	BA85.Z	Phase 1	[15]
TRV250	DM2WZ86	Migraine	8A80	Phase 1	[16]

9 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
DPI-3290	DMKGXT2	Pain	MG30-MG3Z	Discontinued in Phase 2	[17]
Dynorphin A	DMT2WVP	N. A.	N. A.	Discontinued in Phase 2	[18]
TRK-851	DMZ5RA7	Cough	MD12	Discontinued in Phase 1	[19], [20]
VP004	DMXK8FQ	Substance use disorder	6C4Z	Discontinued in Phase 1	[21]
BIPHALIN	DMKNS10	N. A.	N. A.	Terminated	[25]
BW 373U86	DMXFZWJ	N. A.	N. A.	Terminated	[26]
SB-213698	DM58PKG	N. A.	N. A.	Terminated	[27]
SB-219825	DMQW6B0	Pain	MG30-MG3Z	Terminated	[28]
SNF-9007	DM4CNM9	N. A.	N. A.	Terminated	[29]

3 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
BIO-306	DMPUBK8	Migraine	8A80	Preclinical	[22]
LY-25582	DM2N637	Obesity	5B81	Preclinical	[23]
SoRI-9409	DMSNX4O	Alcohol dependence	6C40.2	Preclinical	[24]

373 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(-)-cyclorphan	DMC8WS4	Discovery agent	N.A.	Investigative	[30]
(-)-eseroline	DMJD34Q	Discovery agent	N.A.	Investigative	[31]
(-)-isoelaeocarpiline	DMJS6IZ	Discovery agent	N.A.	Investigative	[32]
(H-Dmt-Tic-Glu-NH-(CH(2))(5)-CO-Dap(6DMN)-NH(2)	DMSCQ64	Discovery agent	N.A.	Investigative	[33]
1,10-bis-(Dmt-Tic-amino)decane	DM9UGFQ	Discovery agent	N.A.	Investigative	[34]
1,4-bis-(Dmt-Tic-amino)butane	DMLBHXN	Discovery agent	N.A.	Investigative	[34]
1,6-bis-(Dmt-Tic-amino)hexane	DMRG2CU	Discovery agent	N.A.	Investigative	[34]
1,6-bis-(N,N-dimethyl-Dmt-Tic-NH)hexane	DMMUZK9	Discovery agent	N.A.	Investigative	[34]
1-(1,2-diphenylethyl)-4-phenylpiperidin-4-ol	DMOR9EK	Discovery agent	N.A.	Investigative	[35]
1-(2-ethoxy-1-phenylethyl)-4-phenylpiperidin-4-ol	DMV3FSH	Discovery agent	N.A.	Investigative	[35]
1-(dio-tolylmethyl)-4-phenylpiperidin-4-ol	DMLYO8P	Discovery agent	N.A.	Investigative	[35]
1-benzhydryl-4-(2-fluorophenyl)piperidin-4-ol	DMTANPG	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-(2-methoxyphenyl)piperidin-4-ol	DMWHMNY	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-(3-fluorophenyl)piperidin-4-ol	DMXZFPB	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-(3-methoxyphenyl)piperidin-4-ol	DM1QYS8	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-(3-phenylpropyl)piperidin-4-ol	DMIT7SH	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-(4-bromophenyl)piperidin-4-ol	DM0BQYX	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-(4-chlorophenyl)piperidin-4-ol	DMWYG8K	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-(4-fluorophenyl)piperidin-4-ol	DMRNZD6	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-(4-methoxyphenyl)piperidin-4-ol	DMXT894	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-(benzyloxy)-4-phenylpiperidine	DMDRUBL	Discovery agent	N.A.	Investigative	[35]
1-benzhydryl-4-(furan-2-yl)piperidin-4-ol	DMMB2GV	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-(thiophen-2-yl)piperidin-4-ol	DMNOZR2	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-benzylpiperidin-4-ol	DMVBR36	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-butylpiperidin-4-ol	DMRN7SC	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-cyclohexylpiperidin-4-ol	DMZVSYD	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-ethoxy-4-phenylpiperidine	DM6PIL2	Discovery agent	N.A.	Investigative	[35]
1-benzhydryl-4-hexylpiperidin-4-ol	DMUK95S	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-m-tolylpiperidin-4-ol	DMVJH1S	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-methoxy-4-phenylpiperidine	DMBG0N8	Discovery agent	N.A.	Investigative	[35]
1-benzhydryl-4-o-tolylpiperidin-4-ol	DMVUMSF	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-p-tolylpiperidin-4-ol	DM679RC	Discovery agent	N.A.	Investigative	[36]
1-benzhydryl-4-phenyl-4-propoxypiperidine	DMEB968	Discovery agent	N.A.	Investigative	[35]
1-benzhydryl-4-phenylpiperidin-4-ol	DM7KU1X	Discovery agent	N.A.	Investigative	[37]
1-[3-(3-biphenyl)-(1,2,4-triazol-4-yl) ]-3-phenol	DMLRS8I	Discovery agent	N.A.	Investigative	[38]
1-[3-(4-biphenyl)-(1,2,4-triazol-4-yl) ]-3-phenol	DMB1NF0	Discovery agent	N.A.	Investigative	[38]
14-O-phenylpropylnaltrexone	DMI7LXH	Discovery agent	N.A.	Investigative	[39]
17-(Cyclobutylmethyl)-N-phenylmorphinan-3-amine	DMUQWPZ	Discovery agent	N.A.	Investigative	[40]
17-(Cyclopropylmethyl)-N-phenylmorphinan-3-amine	DM174HN	Discovery agent	N.A.	Investigative	[40]
17-methyl-4'-methyldihydromorphinone	DMMEB64	Discovery agent	N.A.	Investigative	[41]
17-Methylmorphinan-3-yl 4-Iodophenyl Carbamate	DMI4WCQ	Discovery agent	N.A.	Investigative	[40]
2-Hydroxymethyl-3-hydroxymorphinan	DM4LMPD	Discovery agent	N.A.	Investigative	[40]
3,6-bis(Dmt-Tic-NH-butyl)-2(1H)-pyrazinone	DMWTP7Y	Discovery agent	N.A.	Investigative	[34]
3,6-bis(Dmt-Tic-NH-ethyl)-2(1H)-pyrazinone	DM2Y4A6	Discovery agent	N.A.	Investigative	[34]
3,6-bis(Dmt-Tic-NH-methyl)-2(1H)-pyrazinone	DMJR983	Discovery agent	N.A.	Investigative	[34]
3,6-bis(Dmt-Tic-NH-propyl)-2(1H)-pyrazinone	DMEQBS3	Discovery agent	N.A.	Investigative	[34]
3-desoxy-3-carboxamidonaltrexone	DMBNA0V	Discovery agent	N.A.	Investigative	[42]
3-Methylfentanyl	DMX71N9	Discovery agent	N.A.	Investigative	[43]
3-Methylthiofentanyl	DMC153X	Discovery agent	N.A.	Investigative	[44]
4-(4-((phenethylamino)methyl)phenoxy)benzamide	DM0QRJ3	Discovery agent	N.A.	Investigative	[45]
4-(p-Tolyl)spiro[chromene-2,4'-piperidine]	DMIOQJD	Discovery agent	N.A.	Investigative	[46]
4-(Spiro[chromene-2,4'-piperidine]-4-yl)benzamide	DM0XDG6	Discovery agent	N.A.	Investigative	[47]
4-(Spiro[chromene-2,4'-piperidine]-4-yl)phenol	DM8ZRAE	Discovery agent	N.A.	Investigative	[46]
4-phenyl-1-(1-phenylbutyl)piperidin-4-ol	DMVCIJB	Discovery agent	N.A.	Investigative	[35]
4-phenyl-1-(1-phenylheptyl)piperidin-4-ol	DMISTXQ	Discovery agent	N.A.	Investigative	[35]
4-phenyl-1-(1-phenylhexyl)piperidin-4-ol	DM1GRWY	Discovery agent	N.A.	Investigative	[35]
4-phenyl-1-(1-phenylpentyl)piperidin-4-ol	DMZQ7DP	Discovery agent	N.A.	Investigative	[35]
4-phenyl-1-(phenyl(m-tolyl)methyl)piperidin-4-ol	DMFV0JC	Discovery agent	N.A.	Investigative	[35]
4-phenyl-1-(phenyl(o-tolyl)methyl)piperidin-4-ol	DM2MPWC	Discovery agent	N.A.	Investigative	[35]
4-phenyl-1-(phenyl(p-tolyl)methyl)piperidin-4-ol	DM5R6T4	Discovery agent	N.A.	Investigative	[35]
4-phenyl-4-[1H-imidazol-2-yl]-piperidine	DMPY4G1	Discovery agent	N.A.	Investigative	[48]
4-Phenylspiro[chromene-2,4'-piperidine]	DMW46K7	Discovery agent	N.A.	Investigative	[46]
5-(4-((phenethylamino)methyl)phenoxy)picolinamide	DMZYE8W	Discovery agent	N.A.	Investigative	[45]
6-(2-phenethylisoindolin-5-yloxy)nicotinamide	DMQOJBN	Discovery agent	N.A.	Investigative	[49]
6-(4-((benzylamino)methyl)phenoxy)nicotinamide	DMEM1BA	Discovery agent	N.A.	Investigative	[45]
6-(4-((phenethylamino)methyl)phenoxy)nicotinamide	DM9VD4W	Discovery agent	N.A.	Investigative	[49]
6-(4-(2-(benzylamino)ethyl)phenoxy)nicotinamide	DMDKOWP	Discovery agent	N.A.	Investigative	[49]
6-(4-(3-(benzylamino)propyl)phenoxy)nicotinamide	DMDTMB7	Discovery agent	N.A.	Investigative	[45]
6-(Allyl-methyl-amino)-4,4-diphenyl-heptan-3-ol	DMYMJHF	Discovery agent	N.A.	Investigative	[50]
6-cinnamoyl-N-methylstephasunoline	DMPXS9F	Discovery agent	N.A.	Investigative	[51]
6-cinnamoylhernandine	DMPULH3	Discovery agent	N.A.	Investigative	[51]
6-desoxonaltrexone	DMGZQNS	Discovery agent	N.A.	Investigative	[42]
6beta-naltrexol HCl	DMZ8PBE	Discovery agent	N.A.	Investigative	[52]
7-benzylidenenaltrexone	DMCJED6	Discovery agent	N.A.	Investigative	[53]
8-azabicyclo[3.2.1]octan-3-yloxy-benzamide	DMQMSZR	Discovery agent	N.A.	Investigative	[54]
8-carboxamidocyclazocine	DMD18V5	Discovery agent	N.A.	Investigative	[55]
AKNADILACTAM	DM4E6H1	Discovery agent	N.A.	Investigative	[51]
AMINOFENTANYL	DM7Y6AL	Discovery agent	N.A.	Investigative	[56]
ANALOG OF DYNORPHIN A	DMYW5JX	Discovery agent	N.A.	Investigative	[18]
Antanal 1	DMGDZ6Q	Discovery agent	N.A.	Investigative	[57]
Antanal 2	DMZSUHY	Discovery agent	N.A.	Investigative	[57]
ARD-412	DM03E28	Premature ejaculation	HA03.0Z	Investigative	[6]
BBI-11008	DMMUIQ6	Pain	MG30-MG3Z	Investigative	[6]
Benzyl derivative of M6G	DMX8W4G	Discovery agent	N.A.	Investigative	[58]
Beta-endorphin	DM7XC6B	Discovery agent	N.A.	Investigative	[59]
Bis-((-)-N-propargylmorphinan-3-yl) sebacoylate	DM0WKNI	Discovery agent	N.A.	Investigative	[30]
BUTORPHAN	DM82KPQ	Discovery agent	N.A.	Investigative	[60]
CARBOXYFENTANYL	DMI7Q61	Discovery agent	N.A.	Investigative	[61]
Cis-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH	DMQUB19	Discovery agent	N.A.	Investigative	[62]
Clocinnamox	DMZLMJH	Discovery agent	N.A.	Investigative	[39]
CTAP	DMLON9K	Discovery agent	N.A.	Investigative	[6]
CTOP	DM7VAJX	Discovery agent	N.A.	Investigative	[57]
CYCLAZOCINE	DMC6DAZ	Discovery agent	N.A.	Investigative	[63]
CYCLORPHAN	DMB1U8V	Discovery agent	N.A.	Investigative	[40]
C[L-mTyr-D-pro-L-Phe-D-trp]	DMNHSR0	Discovery agent	N.A.	Investigative	[64]
C[L-Phe-D-pro-L-mTyr-D-trp]	DM82ZOM	Discovery agent	N.A.	Investigative	[64]
C[L-Phe-D-pro-L-Phe-L-trp]	DMCY4L0	Discovery agent	N.A.	Investigative	[64]
D-Phe-Cys-Tyr-D-Trp-Arg-Thr-Pen-Thr-NH2(CTAP)	DM2EFLA	Discovery agent	N.A.	Investigative	[65]
D-Phe-Cys-Tyr-D-Trp-Lys-Thr-Pen-Thr-NH2(CTP)	DMPQHRC	Discovery agent	N.A.	Investigative	[65]
D-Phe-Cys-Tyr-D-Trp-Orn-Thr-Pen-Thr-NH2(CTOP)	DMX1IYO	Discovery agent	N.A.	Investigative	[65]
D-PhGly-Cys-Tyr-D-Trp-Lys-Thr-Pen-Thr-NH2	DMMXA5K	Discovery agent	N.A.	Investigative	[65]
Dadle	DMRM0OW	Discovery agent	N.A.	Investigative	[66], [67]
DAMGO	DMS1DVA	Discovery agent	N.A.	Investigative	[68]
Dcp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2	DMU287Q	Discovery agent	N.A.	Investigative	[69]
DELTORPHIN	DMHOT9P	Discovery agent	N.A.	Investigative	[70]
DELTORPHIN-II	DM9ZWRK	Discovery agent	N.A.	Investigative	[71]
Deprotected cogener of M6G	DMH340E	Discovery agent	N.A.	Investigative	[58]
DERMORPHIN	DMCYQHO	Discovery agent	N.A.	Investigative	[72]
Dhp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2	DMSN87T	Discovery agent	N.A.	Investigative	[69]
Dihydromorphine	DM4TR0D	Discovery agent	N.A.	Investigative	[73]
Dimepheptanol	DMRMHE8	Discovery agent	N.A.	Investigative	[50]
Dimethylthiambutene	DM7EKAF	Discovery agent	N.A.	Investigative	[74]
Diprenorphine	DMIXPU6	Discovery agent	N.A.	Investigative	[75]
Dmt-Pro-3,5Dmp-Phe-NH2	DM5WEFK	Discovery agent	N.A.	Investigative	[76]
Dmt-Pro-Dmp-Phe-NH2	DMGUIR1	Discovery agent	N.A.	Investigative	[76]
Dmt-Pro-Dmt-Phe-NH2	DM4VEU2	Discovery agent	N.A.	Investigative	[76]
Dmt-Pro-Emp-Phe-NH2	DM06VGY	Discovery agent	N.A.	Investigative	[76]
Dmt-Pro-Imp-Phe-NH2	DMXUI1J	Discovery agent	N.A.	Investigative	[76]
Dmt-Pro-Mmp-Phe-NH2	DM78PFN	Discovery agent	N.A.	Investigative	[76]
Dmt-Pro-Phe-D-1-Nal-NH2	DM0VCWA	Discovery agent	N.A.	Investigative	[77]
Dmt-Pro-Phe-D-2-Nal-NH2	DMRJVE8	Discovery agent	N.A.	Investigative	[77]
Dmt-Pro-Phe-Phe-NH2	DMM8BIE	Discovery agent	N.A.	Investigative	[76]
Dmt-Pro-Tmp-Phe-NH2	DMEMQAK	Discovery agent	N.A.	Investigative	[76]
Dmt-Pro-Trp-D-2-Nal-NH2	DMKEV5U	Discovery agent	N.A.	Investigative	[77]
DPDPE	DMIRSNA	Discovery agent	N.A.	Investigative	[68]
DPI-221	DME5S3C	Urinary incontinence	MF50.2	Investigative	[6]
DSLET	DMSTOB0	Discovery agent	N.A.	Investigative	[6]
DSTBULET	DMSVP1K	Discovery agent	N.A.	Investigative	[78]
dynorphin B	DMSPVLM	Discovery agent	N.A.	Investigative	[6]
ELAEOCARPENINE	DMRHSCQ	Discovery agent	N.A.	Investigative	[79]
ENDOMORPHIN 2	DMOQWBU	Discovery agent	N.A.	Investigative	[80]
ENDOMORPHIN-1	DMBJUEM	Discovery agent	N.A.	Investigative	[81]
ethyketazocine	DM7390Y	Discovery agent	N.A.	Investigative	[82]
ethylketocyclazocine	DM9YRCU	Discovery agent	N.A.	Investigative	[6]
ETONITAZENE	DMFR1SE	Discovery agent	N.A.	Investigative	[83]
Etorphine	DM79YZN	Discovery agent	N.A.	Investigative	[84]
FALCARINDIOL	DMLOV18	Discovery agent	N.A.	Investigative	[85]
Grandisine C	DMVLQUP	Discovery agent	N.A.	Investigative	[32]
Grandisine D	DM0JHYF	Discovery agent	N.A.	Investigative	[32]
Grandisine F	DM04S2P	Discovery agent	N.A.	Investigative	[32]
H-2',6'-dimethyltyrosine-Tic-OH	DMYOADQ	N. A.	N. A.	Investigative	[86]
H-2',6'-dimethyltyrosine-Tic-Phe-Phe-OH	DM7IEU2	Discovery agent	N.A.	Investigative	[86]
H-Aba-ala-Gly-Phe-leu-OH	DM61G0I	Discovery agent	N.A.	Investigative	[10]
H-Aba-ala-Gly-Phe-Met-OH	DMKD94Q	Discovery agent	N.A.	Investigative	[10]
H-Aba-Gly-Gly-Phe-Leu-OH	DMH1L3P	Discovery agent	N.A.	Investigative	[10]
H-Aba-ser-Gly-Phe-Leu-Thr-OH	DMFE3J4	Discovery agent	N.A.	Investigative	[10]
H-Apa-ala-Gly-Phe-leu-OH	DM5SUYP	Discovery agent	N.A.	Investigative	[10]
H-Cdp-ala-Gly-Phe-leu-OH	DMV751G	Discovery agent	N.A.	Investigative	[10]
H-Cdp-Gly-Gly-Phe-Leu-OH	DMVEB8C	Discovery agent	N.A.	Investigative	[10]
H-Cdp-ser-Gly-Phe-Leu-Thr-OH	DMCDLTV	Discovery agent	N.A.	Investigative	[10]
H-Cpa-c[pen-Gly-Phe-pen]OH	DM3V4XG	Discovery agent	N.A.	Investigative	[10]
H-Cpa-Gly-Gly-Phe-Met-NH2	DMU6PV8	Discovery agent	N.A.	Investigative	[10]
H-Cpa-Gly-Gly-Phe-Met-OH	DM154G2	Discovery agent	N.A.	Investigative	[10]
H-Cxp-ala-Gly-Phe-leu-OH	DMPL0BR	Discovery agent	N.A.	Investigative	[10]
H-D-Tca-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2	DMY4QE6	Discovery agent	N.A.	Investigative	[87]
H-D-Tic-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2	DM8GC36	Discovery agent	N.A.	Investigative	[87]
H-D-Trp-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2	DMNAE6J	Discovery agent	N.A.	Investigative	[87]
H-Dmt-Aba-Gly-NH-CH2-Bid	DM9WJZK	Discovery agent	N.A.	Investigative	[88]
H-Dmt-Aba-Gly-NH-CH2-Ph	DM61CMS	Discovery agent	N.A.	Investigative	[88]
H-Dmt-Aba-Gly-NH-Ph	DMCQYIJ	Discovery agent	N.A.	Investigative	[88]
H-Dmt-D-Arg(NO2)-Phe-Lys(Z)-NH2	DMHK70B	Discovery agent	N.A.	Investigative	[89]
H-Dmt-D-Arg(NO2)-Phe-Lys(Z)-OH	DMM9EPQ	Discovery agent	N.A.	Investigative	[89]
H-Dmt-Tic-(2R,3R)-beta-MeCha-Phe-NH2	DM1ZDJ6	Discovery agent	N.A.	Investigative	[90]
H-Dmt-Tic-(2R,3R)-beta-MeCha-Phe-OH	DMC3APN	Discovery agent	N.A.	Investigative	[90]
H-Dmt-Tic-(2R,3S)-beta-MeCha-Phe-NH2	DMY97TN	Discovery agent	N.A.	Investigative	[90]
H-Dmt-Tic-(2R,3S)-beta-MeCha-Phe-OH	DMGPAM0	Discovery agent	N.A.	Investigative	[90]
H-Dmt-Tic-(2S,3R)-beta-MeCha-Phe-NH2	DMOI1U5	Discovery agent	N.A.	Investigative	[90]
H-Dmt-Tic-(2S,3R)-beta-MeCha-Phe-OH	DMZBFJ5	Discovery agent	N.A.	Investigative	[90]
H-Dmt-Tic-(2S,3S)-beta-MeCha-Phe-NH2	DMNS1GX	Discovery agent	N.A.	Investigative	[90]
H-Dmt-Tic-(2S,3S)-beta-MeCha-Phe-OH	DMM9TUR	Discovery agent	N.A.	Investigative	[90]
H-Dmt-Tic-Asp-N(Me)-Ph	DM4JP8L	Discovery agent	N.A.	Investigative	[91]
H-Dmt-Tic-Asp-NH-Bzl	DMBKOJG	Discovery agent	N.A.	Investigative	[91]
H-Dmt-Tic-Asp-NH-Ph	DM3W9FQ	Discovery agent	N.A.	Investigative	[91]
H-Dmt-Tic-D-Asp-N(Me)-Ph	DM483BG	Discovery agent	N.A.	Investigative	[91]
H-Dmt-Tic-D-Asp-NH-Ph	DMUG7X1	Discovery agent	N.A.	Investigative	[91]
H-Dmt-Tic-Glu-Dap(6DMN)-NH(2)	DMQSRPD	Discovery agent	N.A.	Investigative	[33]
H-Dmt-Tic-Glu-NH-(CH2)5-NH2	DMF52SH	Discovery agent	N.A.	Investigative	[92]
H-Dmt-Tic-Glu-NH2	DM8A573	Discovery agent	N.A.	Investigative	[92]
H-Dmt-Tic-Gly-N(Me)-Ph	DMHYKBC	Discovery agent	N.A.	Investigative	[91]
H-Dmt-Tic-Gly-NH-Bzl	DMM39YW	Discovery agent	N.A.	Investigative	[91]
H-Dmt-Tic-Gly-NH-CH2-Bid	DMH6JOU	Discovery agent	N.A.	Investigative	[88]
H-Dmt-Tic-Gly-NH-Ph	DMIZ28H	Discovery agent	N.A.	Investigative	[91]
H-Dmt-Tic-Lys(Ac)-NH-CH2-Ph	DM2TY43	Discovery agent	N.A.	Investigative	[93]
H-Dmt-Tic-Lys(Ac)-NH-Ph	DMZH9P5	Discovery agent	N.A.	Investigative	[93]
H-Dmt-Tic-Lys(Z)-NH-CH2-Ph	DMP8HFA	Discovery agent	N.A.	Investigative	[93]
H-Dmt-Tic-Lys(Z)-NH-Ph	DMBXGLA	Discovery agent	N.A.	Investigative	[93]
H-Dmt-Tic-Lys-NH-CH2-Ph	DMDJ9PE	Discovery agent	N.A.	Investigative	[93]
H-Dmt-Tic-Lys-NH-Ph	DMT3Y6E	Discovery agent	N.A.	Investigative	[93]
H-Dmt-Tic-NH-(CH2)6-NH-Dmt-H	DMMJ9YN	Discovery agent	N.A.	Investigative	[94]
H-Dmt-Tic-NH-(CH2)6-NH-Phe-H	DM0BGNE	Discovery agent	N.A.	Investigative	[94]
H-Dmt-Tic-NH-(CH2)6-NH-Tic-H	DMQ586T	Discovery agent	N.A.	Investigative	[94]
H-Dmt-Tic-NH-(D)-CH[(CH2)4-NH-Z]-Bid	DMAU2H6	Discovery agent	N.A.	Investigative	[93]
H-Dmt-Tic-NH-(R)CH(CH2-COOH)-Bid	DM5TZ1J	Discovery agent	N.A.	Investigative	[91]
H-Dmt-Tic-NH-(R)CH(CH2-COOH)-Bid(N1-Me)	DMIDLPT	Discovery agent	N.A.	Investigative	[91]
H-Dmt-Tic-NH-(S)CH(CH2-COOH)-Bid(N1-Me)	DMNEAQ9	Discovery agent	N.A.	Investigative	[91]
H-Dmt-Tic-NH-CH2-Boa	DM4IUCW	Discovery agent	N.A.	Investigative	[95]
H-Dmt-Tic-NH-CH2-Bta	DMZ8C0U	Discovery agent	N.A.	Investigative	[95]
H-Dmt-Tic-NH-CH2-CH2-NH2	DMYJAW4	Discovery agent	N.A.	Investigative	[96]
H-Dmt-Tic-NH-CH2-Imid	DMJ2F8M	Discovery agent	N.A.	Investigative	[95]
H-Dmt-Tic-NH-CH2-ImidPh	DMKGIQJ	Discovery agent	N.A.	Investigative	[95]
H-Dmt-Tic-NH-CH2-Indl	DMNY3A1	Discovery agent	N.A.	Investigative	[95]
H-Dmt-Tic-NH-CH2-Indn	DMZWUFK	Discovery agent	N.A.	Investigative	[95]
H-Dmt-Tic-NH-CH[(CH2)4-NH-Ac]-Bid	DM8PJ92	Discovery agent	N.A.	Investigative	[93]
H-Dmt-Tic-NH-CH[(CH2)4-NH-Z]-Bid	DMQ4ILK	Discovery agent	N.A.	Investigative	[93]
H-Dmt-Tic-NH-CH[(CH2)4-NH2]-Bid	DMQEDP5	Discovery agent	N.A.	Investigative	[93]
H-mCpa-ala-Gly-Phe-leu-OH	DM17QMV	Discovery agent	N.A.	Investigative	[10]
H-mCpa-Gly-Gly-Phe-Leu-OH	DMKAEQP	Discovery agent	N.A.	Investigative	[10]
H-mCpa-ser-Gly-Phe-Leu-Thr-OH	DM8OUHV	Discovery agent	N.A.	Investigative	[10]
H-Poa-ser-Gly-Phe-Leu-Thr-OH	DME1CT9	Discovery agent	N.A.	Investigative	[10]
H-Tyr-c[cys-Gly-Phe(p-NO2)-cys]NH2	DMP8KMV	Discovery agent	N.A.	Investigative	[10]
H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]-OH	DMA2CZL	Discovery agent	N.A.	Investigative	[62]
H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]NH2	DM48XV0	Discovery agent	N.A.	Investigative	[97]
H-Tyr-c[D-Allylgly-Gly-Phe-L-Allylgly]NH2	DMXPJHB	Discovery agent	N.A.	Investigative	[97]
H-Tyr-c[D-Cys-Gly-Phe-D-Cys]NH2	DM7QAES	Discovery agent	N.A.	Investigative	[97]
H-Tyr-c[D-Cys-Gly-Phe-L-Cys]NH2	DMZSTL5	Discovery agent	N.A.	Investigative	[97]
H-Tyr-c[D-Orn-(D or L)Atc-Glu]-NH2	DMI7CR9	Discovery agent	N.A.	Investigative	[98]
H-Tyr-c[D-Orn-Aic-Glu]-NH2	DMOTI0P	Discovery agent	N.A.	Investigative	[98]
H-Tyr-c[pen-Gly-Phe-pen]OH	DMAKPM1	Discovery agent	N.A.	Investigative	[10]
H-Tyr-D-Ala-Gly Phe-Pro-Leu-Trp-O-3,5-Bzl(CF3)2	DMDF9AS	Discovery agent	N.A.	Investigative	[99]
H-Tyr-D-Ala-Gly-Phe-NH-NH-(NMe)Phe-Asp-Nle-Trp-Ac	DM4VBDW	Discovery agent	N.A.	Investigative	[100]
H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Phe-D-Asp-D-Nle-Trp-H	DM0J8P6	Discovery agent	N.A.	Investigative	[101]
H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Trp-Nle-Asp-Phe-Bo	DMW50ZQ	Discovery agent	N.A.	Investigative	[101]
H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Trp-Nle-Asp-Phe-H	DMF82C1	Discovery agent	N.A.	Investigative	[101]
H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-D-Trp-Boc	DM6UWKL	Discovery agent	N.A.	Investigative	[100]
H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-D-Trp-H	DMSXD63	Discovery agent	N.A.	Investigative	[100]
H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-Trp-Ac	DMRUD37	Discovery agent	N.A.	Investigative	[100]
H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-Trp-Boc	DMIPXCZ	Discovery agent	N.A.	Investigative	[100]
H-Tyr-D-Ala-Gly-Phe-NH-NH-Trp-D-Nle-D-Asp-D-Phe-H	DMFSKDM	Discovery agent	N.A.	Investigative	[101]
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NH-3,5-Bzl(CF3)2	DM2K16M	Discovery agent	N.A.	Investigative	[99]
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NH-Bzl	DMRE4ZI	Discovery agent	N.A.	Investigative	[99]
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NMe-3,5-Bzl(CF3)2	DM1ESMZ	Discovery agent	N.A.	Investigative	[99]
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NMe-Bzl	DM56KDV	Discovery agent	N.A.	Investigative	[99]
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-O-Bzl	DMH3YKR	Discovery agent	N.A.	Investigative	[99]
H-Tyr-Gly-Gly-Phe-Met-NH2	DM6D0ZS	Discovery agent	N.A.	Investigative	[10]
H-Tyr-NMe-D-Ala-Phe-Sar-NH2	DM1NT5G	Discovery agent	N.A.	Investigative	[102]
H-Tyr-Pro-Dap(6DMN)-Phe-NH2	DMQUNGC	Discovery agent	N.A.	Investigative	[33]
H-Tyr-Pro-Phe-Phe-NH-(CH2)5-(C=O)-Dap(6DMN)-NH2	DM326GJ	Discovery agent	N.A.	Investigative	[33]
H-Tyr-Pro-Phe-Phe-NH-CH2-CH2-NH Tic Dmt-H	DMXQUKJ	Discovery agent	N.A.	Investigative	[96]
H-Tyr-Tic-Cha-Phe-OH	DM1VFLG	Discovery agent	N.A.	Investigative	[90]
H-Tyr-Tic-OH	DMIU52O	Discovery agent	N.A.	Investigative	[86]
H-Tyr-Tic-Phe-Phe-OH	DMI0U87	Discovery agent	N.A.	Investigative	[103], [90]
HERKINORIN	DMJXBWV	Discovery agent	N.A.	Investigative	[15]
HTyr-Gly-Gly-Phe-Leu-Arg-Arg-lle-Arg-Pro-LysNH2	DM25KZE	Discovery agent	N.A.	Investigative	[104]
ICI 154129	DMN6UET	Discovery agent	N.A.	Investigative	[105]
ICI-174864	DM1D6CQ	Discovery agent	N.A.	Investigative	[106]
ICI-199441	DMEWZ80	Discovery agent	N.A.	Investigative	[107]
Isoelaeocarpine	DMSLO71	Discovery agent	N.A.	Investigative	[108]
Leucine-enkephalin	DMT2CZK	Discovery agent	N.A.	Investigative	[109]
LOFENTANIL	DMR2WQE	Discovery agent	N.A.	Investigative	[110]
LONGANINE	DMH106Y	Discovery agent	N.A.	Investigative	[51]
Lophocladine a	DM5OHVN	Discovery agent	N.A.	Investigative	[111]
M6G thiosaccharide analogue	DMRB4YV	Discovery agent	N.A.	Investigative	[58]
MC-CAM	DMAHN4L	Discovery agent	N.A.	Investigative	[112]
MCL-117	DMQIGZ7	Discovery agent	N.A.	Investigative	[30]
MCL-139	DMQ1BDZ	Discovery agent	N.A.	Investigative	[30]
MCL-144	DMW7ZF8	Discovery agent	N.A.	Investigative	[113]
MCL-145	DMJXU67	Discovery agent	N.A.	Investigative	[30]
MCL-147	DMH5SMT	Discovery agent	N.A.	Investigative	[114]
MCL-149	DMTWY94	Discovery agent	N.A.	Investigative	[114]
MCL-153	DMCPW5F	Discovery agent	N.A.	Investigative	[60]
MCL-154	DM3PIHV	Discovery agent	N.A.	Investigative	[60]
MCL-182	DM39YW1	Discovery agent	N.A.	Investigative	[114]
MCL-183	DMVR51Z	Discovery agent	N.A.	Investigative	[114]
MCL-428	DMXBHE4	Discovery agent	N.A.	Investigative	[115]
MCL-429	DM1XH04	Discovery agent	N.A.	Investigative	[115]
MCL-431	DMISHCW	Discovery agent	N.A.	Investigative	[115]
MCL-432	DMPOFAR	Discovery agent	N.A.	Investigative	[115]
MCL-433	DMD3OAQ	Discovery agent	N.A.	Investigative	[115]
MCL-434	DMR31VO	Discovery agent	N.A.	Investigative	[115]
MCL-435	DMLSYD9	Discovery agent	N.A.	Investigative	[115]
MCL-443	DM8LTQ4	Discovery agent	N.A.	Investigative	[115]
MCL-444	DM8HALS	Discovery agent	N.A.	Investigative	[115]
MCL-445	DMR2K4F	Discovery agent	N.A.	Investigative	[114]
MCL-446	DMXF73G	Discovery agent	N.A.	Investigative	[114]
MCL-447	DMSTGNH	Discovery agent	N.A.	Investigative	[114]
MCL-448	DMSJGA9	Discovery agent	N.A.	Investigative	[114]
MCL-449	DMQ890N	Discovery agent	N.A.	Investigative	[115]
MCL-450	DM7I6U8	Discovery agent	N.A.	Investigative	[116]
MCL-451	DMP523A	Discovery agent	N.A.	Investigative	[116]
MCL-458	DMZN93Y	Discovery agent	N.A.	Investigative	[114]
MCP-203	DM0GLYB	Major depressive disorder	6A70.3	Investigative	[6]
MCP-204	DM0RZDF	Bladder disease	DC11-DC1Z	Investigative	[6]
MCP-205	DM3RYUZ	Ischemic heart disease	BA40-BA6Z	Investigative	[6]
METAZOCINE	DMB6T23	Discovery agent	N.A.	Investigative	[12]
N-(17-Methylmorphinan-3-yl)-N'-phenylurea	DMFRQ2U	Discovery agent	N.A.	Investigative	[40]
N-(4-Iodophenyl)-N'-(17-methylmorphinan-3-yl)urea	DMHANU5	Discovery agent	N.A.	Investigative	[40]
N-alpha-amidino-Tyr(Me)-Pro-Trp-p-Cl-Phe-NH2	DM8QTSU	Discovery agent	N.A.	Investigative	[117]
N-alpha-amidino-Tyr(Me)-Pro-Trp-Phe-NH2	DMSC9FV	Discovery agent	N.A.	Investigative	[117]
N-Benzyl-17-(cyclobutylmethyl)morphinan-3-amine	DM7SEM1	Discovery agent	N.A.	Investigative	[40]
N-Benzyl-17-(cyclopropylmethyl)morphinan-3-amine	DMLP9VM	Discovery agent	N.A.	Investigative	[40]
N-methylstephisoferulin	DMZYSM1	Discovery agent	N.A.	Investigative	[51]
N-methylstephuline	DM5CR2E	Discovery agent	N.A.	Investigative	[51]
Naltrexone-6-alpha-ol	DMRAN5O	Discovery agent	N.A.	Investigative	[12]
naltriben	DMNDOLZ	Discovery agent	N.A.	Investigative	[118], [119]
NORBINALTORPHIMINE	DMLYZOG	Discovery agent	N.A.	Investigative	[120]
normorphine	DMYQGFJ	Discovery agent	N.A.	Investigative	[6]
NRP290	DMC9XJA	Pain	MG30-MG3Z	Investigative	[6]
O-DESMETHYL TRAMADOL	DM8ZG2I	Discovery agent	N.A.	Investigative	[12]
OXYMORPHINDOLE	DMTP4S2	Discovery agent	N.A.	Investigative	[121]
PERIPENTADENINE	DMN9W56	Discovery agent	N.A.	Investigative	[122]
PHENAZOCINE	DMCTVMI	Discovery agent	N.A.	Investigative	[12]
PROSTEPHABYSSINE	DMI8SH2	Discovery agent	N.A.	Investigative	[51]
quadazocine	DM2Q6JY	Discovery agent	N.A.	Investigative	[6]
RTI-5989-23	DMR4TM1	Discovery agent	N.A.	Investigative	[23]
RTI-5989-25	DMQ28L9	Discovery agent	N.A.	Investigative	[23]
RTI-5989-31	DMZO1QC	Discovery agent	N.A.	Investigative	[123]
SB 227122	DM7S63O	Discovery agent	N.A.	Investigative	[124]
SB-0304	DMOZX0D	Discovery agent	N.A.	Investigative	[102]
SN-11	DMA0JZM	Discovery agent	N.A.	Investigative	[27]
SN-23	DM6O0PD	Discovery agent	N.A.	Investigative	[27]
SN-28	DMB8TJC	Discovery agent	N.A.	Investigative	[125]
SNC-80	DMJI5H0	Discovery agent	N.A.	Investigative	[126], [127]
SOMATOSTATIN	DMIOFQE	Discovery agent	N.A.	Investigative	[65]
TIP	DMZO1FJ	Discovery agent	N.A.	Investigative	[103]
TIPPpsi	DM9FNQ6	Discovery agent	N.A.	Investigative	[128]
Tonazocine mesylate	DMROZL8	Discovery agent	N.A.	Investigative	[127]
Trans-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH	DMBU4KJ	Discovery agent	N.A.	Investigative	[62]
Tyr-(NMe)Ala-L-Phe-D-Pro-NH2	DMIWPKB	Discovery agent	N.A.	Investigative	[129]
Tyr-(R)-Aba-Gly-Phe-NH2	DMDQJUO	Discovery agent	N.A.	Investigative	[130]
Tyr-(S)-Aba-Gly-Phe-NH2	DMYZ792	Discovery agent	N.A.	Investigative	[130]
Tyr-(S)-spiro-Aba-Gly-Phe-NH2	DMT316S	Discovery agent	N.A.	Investigative	[130]
Tyr-D-Ala-Gly-D-Trp-Nle-Asp-Phe-NH2	DM0D1Z5	Discovery agent	N.A.	Investigative	[29]
Tyr-D-Ala-Gly-D-Trp-NMeNle-Asp-Phe-NH2	DMPH1G0	Discovery agent	N.A.	Investigative	[29]
Tyr-D-Ala-Gly-Phe-Met-NH2	DMC7LND	Discovery agent	N.A.	Investigative	[25]
Tyr-D-Ala-Gly-Phe-Met-Pro-Leu-Trp-NH-Bzl	DMWOP9N	Discovery agent	N.A.	Investigative	[131]
Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-NMeNle-D-Trp-Boc	DMB2TCF	Discovery agent	N.A.	Investigative	[100]
Tyr-D-Ala-Gly-Trp-Nle-Asp-Phe-NH2	DMUXMVQ	Discovery agent	N.A.	Investigative	[29]
Tyr-D-Ala-Gly-Trp-NMeNle-Asp-Phe-NH2	DMREJ69	Discovery agent	N.A.	Investigative	[29]
Tyr-D-Ala-Phe-Asp-Val-Val-Thr[Beta-D-Glc]-Gly-NH2	DMTPLNZ	Discovery agent	N.A.	Investigative	[132]
Tyr-D-Ala-Phe-Glu-Val-Val-Gly-NH2	DMC4NO5	Discovery agent	N.A.	Investigative	[133]
Tyr-D-Ala-Phe-Gly-Tyr-Pro-Thr(Beta-D-Glc)-Gly-NH2	DM4FASR	Discovery agent	N.A.	Investigative	[132]
Tyr-D-Ala-Phe-Thr(-D-Glc)-Tyr-Pro-Ser-NH2	DMB9A46	Discovery agent	N.A.	Investigative	[132]
Tyr-D-Met-Phe-His-Leu-Met-Asp-NH2	DM4YTFP	Discovery agent	N.A.	Investigative	[133]
Tyr-D-Nle-Gly-D-Trp-Nle-Asp-Phe-NH2	DMY9NIJ	Discovery agent	N.A.	Investigative	[29]
Tyr-D-Nle-Gly-D-Trp-NMeNle-Asp-Phe-NH2	DMQREP2	Discovery agent	N.A.	Investigative	[29]
Tyr-D-Nle-Gly-Trp-Nle-Asp-Phe-NH2	DMZ24LN	Discovery agent	N.A.	Investigative	[29]
Tyr-D-Nle-Gly-Trp-NMeNle-Asp-Phe-NH2	DMPSJ72	Discovery agent	N.A.	Investigative	[29]
Tyr-D-Phe-Gly-D-Trp-Nle-Asp-Phe-NH2	DMIWMN6	Discovery agent	N.A.	Investigative	[29]
Tyr-D-Phe-Gly-D-Trp-NMeNle-Asp-Phe-NH2	DM2CEWT	Discovery agent	N.A.	Investigative	[29]
Tyr-D-Phe-Gly-Trp-Nle-Asp-Phe-NH2	DMKM81A	Discovery agent	N.A.	Investigative	[29]
Tyr-D-Phe-Gly-Trp-NMeNle-Asp-Phe-NH2	DMZOTGM	Discovery agent	N.A.	Investigative	[29]
Tyr-D-Pro-Gly-Trp-NMeNle-Asp-Phe-NH2	DMM9H07	Discovery agent	N.A.	Investigative	[29]
Tyr-Gly-Gly-Phe-c(Cys-Arg-Arg-Ile-Cys)-Arg-lys	DMKND2R	Discovery agent	N.A.	Investigative	[18]
Tyr-Gly-Gly-Phe-leu-c(Cys-Arg-Ile-Arg-Cys)-lys	DMG6NDA	Discovery agent	N.A.	Investigative	[18]
Tyr-Gly-Gly-Trp-NMeNle-Asp-Phe-NH2	DMN7290	Discovery agent	N.A.	Investigative	[29]
Tyr-Pro-3,5Dmp-Phe-NH2	DMDCJWU	Discovery agent	N.A.	Investigative	[76]
Tyr-Pro-D-Phe-D-Pro-NH2	DM4ZJR5	Discovery agent	N.A.	Investigative	[129]
Tyr-Pro-D-Phe-Pro-NH2	DMCTSNE	Discovery agent	N.A.	Investigative	[129]
Tyr-Pro-D-Phg-Phe-NH2	DMEDVRN	Discovery agent	N.A.	Investigative	[134]
Tyr-Pro-Dmp-Phe-NH2	DMNXCHT	Discovery agent	N.A.	Investigative	[76]
Tyr-Pro-Dmt-Phe-NH2	DMOU43H	Discovery agent	N.A.	Investigative	[76]
Tyr-Pro-Emp-Phe-NH2	DMUKE43	Discovery agent	N.A.	Investigative	[76]
Tyr-Pro-Gly-Trp-NMeNle-Asp-Phe-NH2	DM8THU2	Discovery agent	N.A.	Investigative	[29]
Tyr-Pro-Imp-Phe-NH2	DMUV3ZW	Discovery agent	N.A.	Investigative	[76]
Tyr-Pro-L-(NMe)Phe-D-Pro-NH2	DMI65GV	Discovery agent	N.A.	Investigative	[129]
Tyr-Pro-L-(NMe)Phe-Pro-NH2	DM1NITL	Discovery agent	N.A.	Investigative	[129]
Tyr-Pro-L-Phe-D-Pro-NH2	DMUVHGS	Discovery agent	N.A.	Investigative	[129]
Tyr-Pro-L-Phe-Pro-NH2	DM8VW3Z	Discovery agent	N.A.	Investigative	[129]
Tyr-Pro-Mmp-Phe-NH	DMRE7G3	Discovery agent	N.A.	Investigative	[76]
Tyr-Pro-Phe-Phe-N(CH3)2	DM5DRIZ	Discovery agent	N.A.	Investigative	[135]
Tyr-Pro-Phe-Phe-NHCH3	DM2U4VI	Discovery agent	N.A.	Investigative	[135]
Tyr-Pro-Phe-Phe-NHNH2	DMY6V9R	Discovery agent	N.A.	Investigative	[135]
Tyr-Pro-Phe-Phe-OC(CH3)3	DMS4P1E	Discovery agent	N.A.	Investigative	[135]
Tyr-Pro-Phe-Phe-OCH2CH3	DMZNHEC	Discovery agent	N.A.	Investigative	[135]
Tyr-Pro-Phe-Phe-OCH2OH	DMFV7NI	Discovery agent	N.A.	Investigative	[135]
Tyr-Pro-Phe-Phe-OCH3	DMRQXHO	Discovery agent	N.A.	Investigative	[135]
Tyr-Pro-Tmp-Phe-NH	DMR3IVB	Discovery agent	N.A.	Investigative	[76]
UFP-502	DMD8BRG	Discovery agent	N.A.	Investigative	[71]
UFP-512	DMYPVSJ	Discovery agent	N.A.	Investigative	[71]
[3H]diprenorphine	DMBMS1U	Discovery agent	N.A.	Investigative	[6]
[3H]naltrindole	DMQW3A9	Discovery agent	N.A.	Investigative	[136], [53]
[Dcp1]Dyn A(1-11)-NH2	DM23GCK	Discovery agent	N.A.	Investigative	[69]
[Leu5]enkephalin	DMA0N32	Discovery agent	N.A.	Investigative	[137]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Rheumatoid arthritis	FA20	Synovial tissue	1.85E-03	-0.85	-2.06
Major depressive disorder	6A20	Pre-frontal cortex	5.52E-01	0.03	0.23

References

• [1] Oxycodone: a pharmacological and clinical review. Clin Transl Oncol. 2007 May;9(5):298-307.
• [2] Butorphanol: effects of a prototypical agonist-antagonist analgesic on kappa-opioid receptors. J Pharmacol Sci. 2005 Jun;98(2):109-16.
• [3] Molecular characterization of eluxadoline as a potential ligand targeting mu-delta opioid receptor heteromers.Biochem Pharmacol.2014 Dec 1;92(3):448-56.
• [4] Identification of opioid ligands possessing mixed micro agonist/delta antagonist activity among pyridomorphinans derived from naloxone, oxymorphone, and hydromorphone [correction of hydropmorphone]. J Med Chem. 2004 Mar 11;47(6):1400-12.
• [5] Loperamide: evidence of interaction with mu and delta opioid receptors. Life Sci. 1983;33 Suppl 1:315-8.
• [6] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 317).
• [7] Preclinical pharmacology of AZD2327: a highly selective agonist of the delta-opioid receptor. J Pharmacol Exp Ther. 2011 Jul;338(1):195-204.
• [8] Wax PM, Becker CE, Curry SC: Unexpected gas casualties in Moscow: a medical toxicology perspective. Ann Emerg Med. 2003 May;41(5):700-5.
• [9] Delta-opioid receptor agonists inhibit neuromuscular transmission in human colon. Eur J Pharmacol. 1994 Sep 1;262(1-2):33-9.
• [10] Further studies of tyrosine surrogates in opioid receptor peptide ligands. Bioorg Med Chem Lett. 2007 May 1;17(9):2656-60.
• [11] Molecular Mechanisms of Opioid Receptor-Dependent Signaling and Behavior. Anesthesiology. 2011 December; 115(6): 1363-1381.
• [12] Syntheses and opioid receptor binding properties of carboxamido-substituted opioids. Bioorg Med Chem Lett. 2009 Jan 1;19(1):203-8.
• [13] US patent application no. 6,924,288, Enantiomerically pure opioid diarylmethylpiperzine and methods of using same.
• [14] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018026)
• [15] Herkinorin analogues with differential beta-arrestin-2 interactions. J Med Chem. 2008 Apr 24;51(8):2421-31.
• [16] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [17] DPI-3290 [(+)-3-((alpha-R)-alpha-((2S,5R)-4-Allyl-2,5-dimethyl-1-piperazinyl)-3-hydroxybenzyl)-N-(3-fluorophenyl)-N-methylbenzamide]. II. A mixed opioid agonist with potent antinociceptive activity and limited effects on respiratory function. J Pharmacol Exp Ther. 2003 Dec;307(3):1227-33.
• [18] Design and synthesis of highly potent and selective cyclic dynorphin A analogs. 2. New analogs. J Med Chem. 1993 Mar 19;36(6):750-7.
• [19] Design and synthesis of a metabolically stable and potent antitussive agent, a novel delta opioid receptor antagonist, TRK-851. Bioorg Med Chem. 2008 Sep 1;16(17):7956-67.
• [20] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
• [21] WO patent application no. 2007,0677,14, Treatment of sequelae of psychiatric disorders.
• [22] Pharmacologic therapeutics for cardiac reperfusion injury. Expert Opin Emerg Drugs. 2007 Sep;12(3):367-88.
• [23] Investigation of the N-substituent conformation governing potency and mu receptor subtype-selectivity in (+)-(3R, 4R)-dimethyl-4-(3-hydroxyphenyl)p... J Med Chem. 1998 May 21;41(11):1980-90.
• [24] In vivo pharmacological characterization of SoRI 9409, a nonpeptidic opioid mu-agonist/delta-antagonist that produces limited antinociceptive tolerance and attenuates morphine physical dependence. J Pharmacol Exp Ther. 2001 May;297(2):597-605.
• [25] The biological activity and metabolic stability of peptidic bifunctional compounds that are opioid receptor agonists and neurokinin-1 receptor anta... Bioorg Med Chem. 2009 Oct 15;17(20):7337-43.
• [26] BW373U86, a delta opioid agonist, partially mediates delayed cardioprotection via a free radical mechanism that is independent of opioid receptor stimulation. J Mol Cell Cardiol. 2001 Aug;33(8):1455-65.
• [27] Design and synthesis of novel delta opioid receptor agonists and their pharmacologies. Bioorg Med Chem Lett. 2009 May 15;19(10):2792-5.
• [28] Mutation W284L of the human delta opioid receptor reveals agonist specific receptor conformations for G protein activation. Life Sci. 2001 Apr 6;68(19-20):2233-42.
• [29] Structure-activity relationships of bifunctional peptides based on overlapping pharmacophores at opioid and cholecystokinin receptors. J Med Chem. 2006 May 18;49(10):2868-75.
• [30] Synthesis and preliminary in vitro investigation of bivalent ligands containing homo- and heterodimeric pharmacophores at mu, delta, and kappa opio... J Med Chem. 2006 Jan 12;49(1):256-62.
• [31] Akuammine and dihydroakuammine, two indolomonoterpene alkaloids displaying affinity for opioid receptors. J Nat Prod. 1992 Mar;55(3):380-4.
• [32] Grandisines C-G, indolizidine alkaloids from the Australian rainforest tree Elaeocarpus grandis. J Nat Prod. 2006 Sep;69(9):1295-9.
• [33] 6-N,N-dimethylamino-2,3-naphthalimide: a new environment-sensitive fluorescent probe in delta- and mu-selective opioid peptides. J Med Chem. 2006 Jun 15;49(12):3653-8.
• [34] Potent Dmt-Tic pharmacophoric delta- and mu-opioid receptor antagonists. J Med Chem. 2005 Dec 15;48(25):8035-44.
• [35] Bioorg Med Chem Lett. 2007 Jun 1;17(11):3023-7. Epub 2007 Mar 23.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 1.
• [36] Bioorg Med Chem Lett. 2007 Jun 1;17(11):3028-33. Epub 2007 Mar 21.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 2.
• [37] The discovery of tropane derivatives as nociceptin receptor ligands for the management of cough and anxiety. Bioorg Med Chem Lett. 2009 May 1;19(9):2519-23.
• [38] Discovery of novel triazole-based opioid receptor antagonists. J Med Chem. 2006 Jul 13;49(14):4044-7.
• [39] 14 beta-O-cinnamoylnaltrexone and related dihydrocodeinones are mu opioid receptor partial agonists with predominant antagonist activity. J Med Chem. 2009 Mar 26;52(6):1553-7.
• [40] Synthesis and opioid receptor binding affinities of 2-substituted and 3-aminomorphinans: ligands for mu, kappa, and delta opioid receptors. J Med Chem. 2010 Jan 14;53(1):402-18.
• [41] Structural determinants of opioid activity in derivatives of 14-aminomorphinones: effect of substitution in the aromatic ring of cinnamoylaminomorp... J Med Chem. 2006 Aug 24;49(17):5333-8.
• [42] Syntheses of novel high affinity ligands for opioid receptors. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2289-94.
• [43] Subramanian G, Paterlini MG, Portoghese PS, Ferguson DM: Molecular docking reveals a novel binding site model for fentanyl at the mu-opioid receptor. J Med Chem. 2000 Feb 10;43(3):381-91.
• [44] You HJ, Colpaert FC, Arendt-Nielsen L: The novel analgesic and high-efficacy 5-HT1A receptor agonist F 13640 inhibits nociceptive responses, wind-up, and after-discharges in spinal neurons and withdrawal reflexes. Exp Neurol. 2005 Jan;191(1):174-83.
• [45] Structure-activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 1. Bioorg Med Chem Lett. 2007 Oct 1;17(19):5349-52.
• [46] Potent, orally bioavailable delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-4-(5-hydroxyspiro[chromene-2,4'-pipe... J Med Chem. 2008 Oct 9;51(19):5893-6.
• [47] Spirocyclic delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-3-hydroxy-4-(spiro[chromene-2,4'-piperidine]-4-yl) b... J Med Chem. 2009 Sep 24;52(18):5685-702.
• [48] 4-Phenyl-4-[1H-imidazol-2-yl]-piperidine derivatives, a novel class of selective delta-opioid agonists. Bioorg Med Chem Lett. 2006 Jan 1;16(1):146-9.
• [49] Structure activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 2. Bioorg Med Chem Lett. 2007 Dec 15;17(24):6841-6.
• [50] Synthesis of analogues of acetylmethadol and methadol as potential narcotic antagonists. J Med Chem. 1981 Jul;24(7):903-6.
• [51] Hasubanan alkaloids with delta-opioid binding affinity from the aerial parts of Stephania japonica. J Nat Prod. 2010 May 28;73(5):988-91.
• [52] Design, synthesis, and characterization of 6beta-naltrexol analogs, and their selectivity for in vitro opioid receptor subtypes. Bioorg Med Chem Lett. 2009 May 15;19(10):2811-4.
• [53] Delta-opioid receptor antagonists as a new concept for central acting antitussive drugs. Pulm Pharmacol Ther. 2002;15(3):235-40.
• [54] SAR development of a series of 8-azabicyclo[3.2.1]octan-3-yloxy-benzamides as kappa opioid receptor antagonists. Part 2. Bioorg Med Chem Lett. 2010 Sep 15;20(18):5405-10.
• [55] Redefining the structure-activity relationships of 2,6-methano-3-benzazocines. Part 6: Opioid receptor binding properties of cyclic variants of 8-c... Bioorg Med Chem. 2008 May 15;16(10):5653-64.
• [56] Synthesis and evaluation of 3-aminopropionyl substituted fentanyl analogues for opioid activity. Bioorg Med Chem Lett. 2006 Sep 15;16(18):4946-50.
• [57] Novel opioid peptide derived antagonists containing (2S)-2-methyl-3-(2,6-dimethyl-4-carbamoylphenyl)propanoic acid [(2S)-Mdcp]. J Med Chem. 2008 Sep 25;51(18):5866-70.
• [58] Synthesis and in vitro biological evaluation of a carbon glycoside analogue of morphine-6-glucuronide. Bioorg Med Chem Lett. 2005 Mar 15;15(6):1583-6.
• [59] Cross-linking of human [125I]beta-endorphin to opioid receptors in rat striatal membranes: biochemical evidence for the existence of a mu/delta opioid receptor complex. J Pharmacol Exp Ther. 1990 Apr;253(1):419-26.
• [60] Effect of linker substitution on the binding of butorphan univalent and bivalent ligands to opioid receptors. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1507-9.
• [61] Development of novel enkephalin analogues that have enhanced opioid activities at both mu and delta opioid receptors. J Med Chem. 2007 Nov 1;50(22):5528-32.
• [62] Synthesis of stable and potent delta/mu opioid peptides: analogues of H-Tyr-c[D-Cys-Gly-Phe-D-Cys]-OH by ring-closing metathesis. J Med Chem. 2007 Jun 28;50(13):3138-42.
• [63] Redefining the structure-activity relationships of 2,6-methano-3-benzazocines. Part 7: syntheses and opioid receptor properties of cyclic variants ... Bioorg Med Chem Lett. 2009 Jan 15;19(2):365-8.
• [64] Nascent structure-activity relationship study of a diastereomeric series of kappa opioid receptor antagonists derived from CJ-15,208. Bioorg Med Chem Lett. 2009 Jul 1;19(13):3647-50.
• [65] Design and synthesis of conformationally constrained somatostatin analogues with high potency and specificity for mu opioid receptors. J Med Chem. 1986 Nov;29(11):2370-5.
• [66] Delta opioid receptor stimulation mimics ischemic preconditioning in human heart muscle. J Am Coll Cardiol. 2000 Dec;36(7):2296-302.
• [67] Design, synthesis, and biological evaluation of novel bifunctional C-terminal-modified peptides for delta/mu opioid receptor agonists and neurokini... J Med Chem. 2007 Jun 14;50(12):2779-86.
• [68] Evaluation of N-substitution in 6,7-benzomorphan compounds. Bioorg Med Chem. 2010 Jul 15;18(14):4975-82.
• [69] Replacement of the N-terminal tyrosine residue in opioid peptides with 3-(2,6-dimethyl-4-carbamoylphenyl)propanoic acid (Dcp) results in novel opio... J Med Chem. 2006 Aug 24;49(17):5382-5.
• [70] Cyclic enkephalin analogs with exceptional potency at peripheral delta opioid receptors. J Med Chem. 1994 Jan 7;37(1):146-50.
• [71] Role of 2',6'-dimethyl-l-tyrosine (Dmt) in some opioid lead compounds. Bioorg Med Chem. 2010 Aug 15;18(16):6024-30.
• [72] Conversion of the potent delta-opioid agonist H-Dmt-Tic-NH-CH(2)-bid into delta-opioid antagonists by N(1)-benzimidazole alkylation(1). J Med Chem. 2005 Dec 29;48(26):8112-4.
• [73] Opiate receptor binding properties of morphine-, dihydromorphine-, and codeine 6-O-sulfate ester congeners. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4291-5.
• [74] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [75] [6-O-methyl-11C]Diprenorphine Molecular Imaging and Contrast Agent Database (MICAD) [Internet].
• [76] Bifunctional [2',6'-dimethyl-L-tyrosine1]endomorphin-2 analogues substituted at position 3 with alkylated phenylalanine derivatives yield potent mi... J Med Chem. 2007 Jun 14;50(12):2753-66.
• [77] Synthesis and characterization of potent and selective mu-opioid receptor antagonists, [Dmt(1), D-2-Nal(4)]endomorphin-1 (Antanal-1) and [Dmt(1), D... J Med Chem. 2007 Feb 8;50(3):512-20.
• [78] [3H][D-Ser2(O-tert-butyl),Leu5]enkephalyl-Thr6 and [D-Ser2(O-tert-butyl),Leu5]enkephalyl-Thr6(O-tert-butyl). Two new enkephalin analogs with both a good selectivity and a high affinity toward delta-opioid binding sites. J Biol Chem. 1988 Mar 25;263(9):4124-30.
• [79] Synthesis and evaluation of opioid receptor-binding affinity of elaeocarpenine and its analogs. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1601-3.
• [80] Synthesis and activity of endomorphin-2 and morphiceptin analogues with proline surrogates in position 2. Eur J Med Chem. 2010 Oct;45(10):4594-600.
• [81] New endomorphin analogues containing alicyclic beta-amino acids: influence on bioactive conformation and pharmacological profile. J Med Chem. 2008 Jul 24;51(14):4270-9.
• [82] Cloning and functional comparison of kappa and delta opioid receptors from mouse brain. Proc Natl Acad Sci U S A. 1993 Jul 15;90(14):6736-40.
• [83] Photoactivatable opiate derivatives as irreversible probes of the mu-opioid receptor. J Med Chem. 1990 Sep;33(9):2456-64.
• [84] Agonist-, antagonist-, and inverse agonist-regulated trafficking of the delta-opioid receptor correlates with, but does not require, G protein activation. J Pharmacol Exp Ther. 2001 Sep;298(3):1015-20.
• [85] Novel coumarin glycoside and phenethyl vanillate from Notopterygium forbesii and their binding affinities for opioid and dopamine receptors. Bioorg Med Chem. 2008 Mar 15;16(6):3218-23.
• [86] Agonist vs antagonist behavior of delta opioid peptides containing novel phenylalanine analogues in place of Tyr(1). J Med Chem. 2009 Nov 12;52(21):6941-5.
• [87] Opiate aromatic pharmacophore structure-activity relationships in CTAP analogues determined by topographical bias, two-dimensional NMR, and biologi... J Med Chem. 2000 Feb 24;43(4):569-80.
• [88] New 2',6'-dimethyl-L-tyrosine (Dmt) opioid peptidomimetics based on the Aba-Gly scaffold. Development of unique mu-opioid receptor ligands. J Med Chem. 2006 Jun 29;49(13):3990-3.
• [89] From the potent and selective mu opioid receptor agonist H-Dmt-d-Arg-Phe-Lys-NH(2) to the potent delta antagonist H-Dmt-Tic-Phe-Lys(Z)-OH. J Med Chem. 2005 Aug 25;48(17):5608-11.
• [90] Beta-methyl substitution of cyclohexylalanine in Dmt-Tic-Cha-Phe peptides results in highly potent delta opioid antagonists. J Med Chem. 2007 Jan 25;50(2):328-33.
• [91] Further studies on lead compounds containing the opioid pharmacophore Dmt-Tic. J Med Chem. 2008 Aug 28;51(16):5109-17.
• [92] Highly selective fluorescent analogue of the potent delta-opioid receptor antagonist Dmt-Tic. J Med Chem. 2004 Dec 16;47(26):6541-6.
• [93] Effect of lysine at C-terminus of the Dmt-Tic opioid pharmacophore. J Med Chem. 2006 Sep 7;49(18):5610-7.
• [94] New series of potent delta-opioid antagonists containing the H-Dmt-Tic-NH-hexyl-NH-R motif. Bioorg Med Chem Lett. 2005 Dec 15;15(24):5517-20.
• [95] Role of benzimidazole (Bid) in the delta-opioid agonist pseudopeptide H-Dmt-Tic-NH-CH(2)-Bid (UFP-502). Bioorg Med Chem. 2008 Mar 15;16(6):3032-8.
• [96] A new opioid designed multiple ligand derived from the micro opioid agonist endomorphin-2 and the delta opioid antagonist pharmacophore Dmt-Tic. Bioorg Med Chem. 2007 Nov 15;15(22):6876-81.
• [97] Dicarba analogues of the cyclic enkephalin peptides H-Tyr-c[D-Cys-Gly-Phe-D(or L)-Cys]NH(2) retain high opioid activity. J Med Chem. 2007 Mar 22;50(6):1414-7.
• [98] Conformational restriction of the phenylalanine residue in a cyclic opioid peptide analogue: effects on receptor selectivity and stereospecificity. J Med Chem. 1991 Oct;34(10):3125-32.
• [99] A structure-activity relationship study and combinatorial synthetic approach of C-terminal modified bifunctional peptides that are delta/mu opioid ... J Med Chem. 2008 Mar 13;51(5):1369-76.
• [100] Design and synthesis of novel hydrazide-linked bifunctional peptides as delta/mu opioid receptor agonists and CCK-1/CCK-2 receptor antagonists. J Med Chem. 2006 Mar 9;49(5):1773-80.
• [101] Partial retro-inverso, retro, and inverso modifications of hydrazide linked bifunctional peptides for opioid and cholecystokinin (CCK) receptors. J Med Chem. 2007 Jan 11;50(1):165-8.
• [102] Blood-brain barrier penetration by two dermorphin tetrapeptide analogues: role of lipophilicity vs structural flexibility. J Med Chem. 2008 Apr 24;51(8):2571-4.
• [103] The TIPP opioid peptide family: development of delta antagonists, delta agonists, and mixed mu agonist/delta antagonists. Biopolymers. 1999;51(6):411-25.
• [104] The effects of C-terminal modifications on the opioid activity of [N-benzylTyr(1)]dynorphin A-(1-11) analogues. J Med Chem. 2009 Nov 12;52(21):6814-21.
• [105] In vivo evidence for the selectivity of ICI 154129 for the delta-opioid receptor. Neuropharmacology. 1985 Feb;24(2):107-10.
• [106] Highly potent and selective phenylmorphan-based inverse agonists of the opioid delta receptor. J Med Chem. 2006 Sep 7;49(18):5597-609.
• [107] Arylacetamide kappa opioid receptor agonists with reduced cytochrome P450 2D6 inhibitory activity. Bioorg Med Chem Lett. 2005 May 16;15(10):2647-52.
• [108] Indolizidine alkaloids with delta-opioid receptor binding affinity from the leaves of Elaeocarpus fuscoides. J Nat Prod. 2007 May;70(5):872-5.
• [109] Inverse agonist action of Leu-enkephalin at delta(2)-opioid receptors mediates spinal antianalgesia. J Pharmacol Exp Ther. 2001 May;297(2):582-9.
• [110] Potential affinity labels for the opiate receptor based on fentanyl and related compounds. J Med Chem. 1982 Aug;25(8):913-9.
• [111] Lophocladines, bioactive alkaloids from the red alga Lophocladia sp. J Nat Prod. 2006 Apr;69(4):640-4.
• [112] 14beta-Arylpropiolylamino-17-cyclopropylmethyl-7,8-dihydronormorphinones and related opioids. Further examples of pseudoirreversible mu opioid rece... J Med Chem. 2009 Nov 12;52(21):6926-30.
• [113] Univalent and bivalent ligands of butorphan: characteristics of the linking chain determine the affinity and potency of such opioid ligands. J Med Chem. 2009 Dec 10;52(23):7389-96.
• [114] In-vitro investigation of oxazol and urea analogues of morphinan at opioid receptors. Bioorg Med Chem. 2007 Jun 15;15(12):4106-12.
• [115] High-affinity carbamate analogues of morphinan at opioid receptors. Bioorg Med Chem Lett. 2007 Mar 15;17(6):1508-11.
• [116] New opioid designed multiple ligand from Dmt-Tic and morphinan pharmacophores. J Med Chem. 2006 Sep 7;49(18):5640-3.
• [117] Endomorphin-1 analogs with enhanced metabolic stability and systemic analgesic activity: design, synthesis, and pharmacological characterization. Bioorg Med Chem. 2007 Feb 15;15(4):1694-702.
• [118] Differential antagonism of delta opioid agonists by naltrindole and its benzofuran analog (NTB) in mice: evidence for delta opioid receptor subtypes. J Pharmacol Exp Ther. 1991 May;257(2):676-80.
• [119] Selective in vivo binding of [3H]naltriben to delta-opioid receptors in mouse brain. Eur J Pharmacol. 1998 Jun 5;350(2-3):335-44.
• [120] Identification of (3R)-7-hydroxy-N-((1S)-1-[[(3R,4R)-4-(3-hydroxyphenyl)- 3,4-dimethyl-1-piperidinyl]methyl]-2-methylpropyl)-1,2,3,4-tetrahydro- 3-... J Med Chem. 2003 Jul 3;46(14):3127-37.
• [121] Ligand binding to nucleic acids and proteins: Does selectivity increase with strength Eur J Med Chem. 2008 Nov;43(11):2307-15.
• [122] Alkaloids with human delta-opioid receptor binding affinity from the Australian rainforest tree Peripentadenia mearsii. J Nat Prod. 2007 Dec;70(12):1946-50.
• [123] Probes for narcotic receptor mediated phenomena. 34. Synthesis and structure-activity relationships of a potent mu-agonist delta-antagonist and an ... J Med Chem. 2007 Aug 9;50(16):3765-76.
• [124] The antitussive activity of delta-opioid receptor stimulation in guinea pigs. J Pharmacol Exp Ther. 2000 Feb;292(2):803-9.
• [125] Design and synthesis of KNT-127, a -opioid receptor agonist effective by systemic administration. Bioorg Med Chem Lett. 2010 Nov 1;20(21):6302-5.
• [126] Nonpeptidic delta-opioid receptor agonists reduce immobility in the forced swim assay in rats. Neuropsychopharmacology. 2002 Jun;26(6):744-55.
• [127] Antiparkinson potential of delta-opioid receptor agonists. Eur J Pharmacol. 2000 May 19;396(2-3):101-7.
• [128] TIPP[psi]: a highly potent and stable pseudopeptide delta opioid receptor antagonist with extraordinary delta selectivity. J Med Chem. 1993 Oct 15;36(21):3182-7.
• [129] A topochemical approach to explain morphiceptin bioactivity. J Med Chem. 1993 Mar 19;36(6):708-19.
• [130] Endomorphin-2 with a beta-turn backbone constraint retains the potent micro-opioid receptor agonist properties. J Med Chem. 2008 Jan 10;51(1):173-7.
• [131] The importance of micelle-bound states for the bioactivities of bifunctional peptide derivatives for delta/mu opioid receptor agonists and neurokin... J Med Chem. 2008 Oct 23;51(20):6334-47.
• [132] Synthesis and pharmacological activity of deltorphin and dermorphin-related glycopeptides. J Med Chem. 1997 Aug 29;40(18):2948-52.
• [133] Design of cyclic deltorphins and dermenkephalins with a disulfide bridge leads to analogues with high selectivity for delta-opioid receptors. J Med Chem. 1994 Jan 7;37(1):141-5.
• [134] Opioid receptor binding and antinociceptive activity of the analogues of endomorphin-2 and morphiceptin with phenylalanine mimics in the position 3... Bioorg Med Chem Lett. 2006 Jul 15;16(14):3688-92.
• [135] Structure-activity study of endomorphin-2 analogs with C-terminal modifications by NMR spectroscopy and molecular modeling. Bioorg Med Chem. 2008 Jun 15;16(12):6415-22.
• [136] Characterization of [3H]naltrindole binding to delta opioid receptors in rat brain. Life Sci. 1992;50(16):PL119-24.
• [137] Carba-analogues of fentanyl are opioid receptor agonists. J Med Chem. 2010 Apr 8;53(7):2875-81.