Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT4TFGN)

• DTT Name: Vasopressin V1a receptor (V1AR)
• Synonyms: Vascular/hepatic-type arginine vasopressin receptor; V1aR; V1a vasopressin receptor; Antidiuretic hormone receptor 1a; AVPR1; AVPR V1a
• Gene Name: AVPR1A
• DTT Type: Successful target; [1]
• Related Disease:
  Acute diabete complication [ICD-11: 5A2Y]
  Autism spectrum disorder [ICD-11: 6A02]
  Hypertension [ICD-11: BA00-BA04]
  Hypo-osmolality/hyponatraemia [ICD-11: 5C72]
  Localisation [ICD-11: N.A.]
• BioChemical Class: GPCR rhodopsin
• UniProt ID: V1AR_HUMAN
• TTD ID: T79232
• Sequence:
  MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAV
  TFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGP
  DWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFV
  LSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGFIC
  YNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIVTAY
  IVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMFFSGHLLQDCV
  QSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST
• Function: The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. Has been involved in social behaviors, including affiliation and attachment. Receptor for arginine vasopressin.
• KEGG Pathway:
  Calcium signaling pathway (hsa04020)
  Neuroactive ligand-receptor interaction (hsa04080)
  Vascular smooth muscle contraction (hsa04270)
• Reactome Pathway:
  G alpha (q) signalling events (R-HSA-416476)
  Vasopressin-like receptors (R-HSA-388479)

Molecular Interaction Atlas (MIA) of This DTT

7 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Conivaptan	DM1V329	Euvolemic hyponatremia	5C72	Approved	[2], [3]
Desmopressin	DMS3GVE	Diabetic complication	5A2Y	Approved	[4]
Felypressin	DMHLP9C	Localisation	N.A.	Approved	[5]
Mozavaptan	DMZ905C	Hyponatraemia	5C72	Approved	[6], [7]
Oxytocin	DMDL27I	Autism spectrum disorder	6A02	Approved	[8]
Terlipressin	DMT9FH3	Hypertension	BA00-BA04	Approved	[1]
ATOSIBAN	DMB7WYM	N. A.	N. A.	Phase 4	[9]

9 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Balovaptan	DMKMTDG	Autism spectrum disorder	6A02	Phase 3	[10]
FE-202158	DM3CVHQ	Sepsis	1G40-1G41	Phase 2	[11]
PMX-53	DMZUAJ4	Atopic dermatitis	EA80	Phase 2	[12]
RG7314	DMB4M6O	Autism spectrum disorder	6A02	Phase 2	[13]
SRX-246	DMMU41F	Anxiety disorder	6B00-6B0Z	Phase 2	[14]
SRX246	DMKOTUJ	Huntington disease	8A01.10	Phase 2	[15]
SSR149415	DMCMD93	Anxiety disorder	6B00-6B0Z	Phase 2	[16]
VA-111913	DMAYWXD	Dysmenorrhea	GA34.3	Phase 2	[17]
SRX-251	DMO1N8A	Dysmenorrhea	GA34.3	Phase 1	[18]

10 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PMID25776143-Compound-1	DMGHSR9	N. A.	N. A.	Patented	[19]
PMID25776143-Compound-2	DMTZRFP	N. A.	N. A.	Patented	[19]
PMID25776143-Compound-3	DMCULI1	N. A.	N. A.	Patented	[19]
PMID25776143-Compound-4	DMMVETJ	N. A.	N. A.	Patented	[19]
PMID25776143-Compound-7	DM7QIMN	N. A.	N. A.	Patented	[19]
PMID25776143-Compound-8	DMUKFJ0	N. A.	N. A.	Patented	[19]
PMID28906174-Compound-figure1g	DMECU90	N. A.	N. A.	Patented	[20]
Pyrrolidine derivative 13	DM3VA8P	N. A.	N. A.	Patented	[20]
Tetra-azabenzo[e]azulene derivative 1	DMLRY53	N. A.	N. A.	Patented	[19]
Tetra-azabenzo[e]azulene derivative 2	DMUEI4N	N. A.	N. A.	Patented	[19]

4 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
OPC-21268	DM7OVMH	Cardiac disease	BA00-BE2Z	Discontinued in Phase 2	[21], [6]
PF-3274167	DMD42MN	Female sexual arousal dysfunction	HA01.1	Discontinued in Phase 1	[22]
JTV-605	DM89TXB	Dysmenorrhea	GA34.3	Terminated	[21]
L-371257	DMCRQTH	N. A.	N. A.	Terminated	[22]

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
NOX-F37	DM83DSA	Acute and chronic heart failure	BD1Z	Preclinical	[23]

53 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
1'-tosylspiro[indene-1,4'-piperidine]	DM9SYEP	Discovery agent	N.A.	Investigative	[22]
A-987306	DMU34BK	Discovery agent	N.A.	Investigative	[24]
ARGENINE VASOPRESSIN	DM8KN0Q	Discovery agent	N.A.	Investigative	[25]
CL-385004	DMLQZGJ	Discovery agent	N.A.	Investigative	[21]
D(CH2)5[Tyr(Me)2,Thr4,Orn8(5/6C-Flu),Tyr-NH29]VT	DMVHMGA	Discovery agent	N.A.	Investigative	[26]
D(CH2)5[Tyr(Me)2,Thr4,Orn8,Tyr9-NH2]VT	DM1BMT7	Discovery agent	N.A.	Investigative	[26]
d(CH2)5[Tyr(Me)2]AVP	DMHTSAX	Discovery agent	N.A.	Investigative	[27]
DesGly-NH2,d(CH2)5[D-Tyr2,Thr4,Orn8(5/6C-Flu)]VT	DMJK0H5	Discovery agent	N.A.	Investigative	[26]
DVDAVP	DM53079	Discovery agent	N.A.	Investigative	[25]
D[Arg4,Dab8]VP	DMCU8HK	Discovery agent	N.A.	Investigative	[25]
D[Arg4,Lys8]VP	DM69OVM	Discovery agent	N.A.	Investigative	[25]
D[Arg4,Orn8]VP	DM8D4QT	Discovery agent	N.A.	Investigative	[25]
D[Arg4]AVP	DM76Q2B	Discovery agent	N.A.	Investigative	[25]
D[Cha4,Dab8]VP	DMCLUXI	Discovery agent	N.A.	Investigative	[25]
D[Cha4,Dap8]VP	DMAPZKB	Discovery agent	N.A.	Investigative	[25]
D[Cha4,Lys8]VP	DM0GO7U	Discovery agent	N.A.	Investigative	[25]
D[Cha4,Orn8]VP	DMZWTJK	Discovery agent	N.A.	Investigative	[25]
D[Cha4]AVP	DM8FCX5	Discovery agent	N.A.	Investigative	[25]
D[D-3-Pal2]AVP	DMD4V6U	Discovery agent	N.A.	Investigative	[25]
D[Leu4,Dab8]VP	DMNSXG9	Discovery agent	N.A.	Investigative	[25]
D[Leu4,Dap8]VP	DME3HK8	Discovery agent	N.A.	Investigative	[25]
D[Leu4,Lys8]VP	DMDBU7Q	Discovery agent	N.A.	Investigative	[25]
D[Leu4,Orn8]VP	DMJCW8Y	Discovery agent	N.A.	Investigative	[25]
D[Leu4]AVP	DMREZT7	Discovery agent	N.A.	Investigative	[25]
D[Lys8(5/6-Flu)]VT	DME2PKB	Discovery agent	N.A.	Investigative	[26]
D[Orn4,Lys8]VP	DMNQTBU	Discovery agent	N.A.	Investigative	[25]
D[Orn4,Orn8]VP	DMONV0M	Discovery agent	N.A.	Investigative	[25]
D[Orn4]AVP	DMJNT95	Discovery agent	N.A.	Investigative	[25]
D[Orn8(5/6C-Flu)]VT	DMH791N	Discovery agent	N.A.	Investigative	[26]
d[Pen1,Tyr(Me)2]AVP	DMT8KI6	Discovery agent	N.A.	Investigative	[28]
D[Thr4,Lys8(5/6C-Flu)]VT	DMS4F8O	Discovery agent	N.A.	Investigative	[26]
D[Thr4,Orn8(5/6C-Flu)]VT	DMBDZQA	Discovery agent	N.A.	Investigative	[26]
D[Val4]AVP	DM3GM8E	Discovery agent	N.A.	Investigative	[25]
HO-LVA	DMJQI7A	Discovery agent	N.A.	Investigative	[29]
Hoo-Phe-Orn-Pro-hle-Pff-Phe-NH2	DMHW2DU	Discovery agent	N.A.	Investigative	[12]
L-372662	DMQV974	Discovery agent	N.A.	Investigative	[22]
L023103	DM9KWUR	Discovery agent	N.A.	Investigative	[30]
LS-192629	DMUBF53	Discovery agent	N.A.	Investigative	[31]
Relcovaptan	DM3AWPB	Discovery agent	N.A.	Investigative	[32], [29]
SSR126768A	DMF0X2S	Discovery agent	N.A.	Investigative	[33]
V1A F/U	DMH971B	Infertility	GB04	Investigative	[34]
YM 218	DMPYM3J	Discovery agent	N.A.	Investigative	[35]
YM 471	DM5BFL4	Discovery agent	N.A.	Investigative	[36]
[HO1][Lys8(5/6C-Flu)]VT	DMLZNK6	Discovery agent	N.A.	Investigative	[26]
[HO1][Orn8(5/6C-Flu)]VT	DMFK9V5	Discovery agent	N.A.	Investigative	[26]
[HO1][Orn8(5/6C-Rhm)]VT	DM7COAM	Discovery agent	N.A.	Investigative	[26]
[HO1][Thr4,Lys8(5/6C-Flu)]VT	DMT2UYR	Discovery agent	N.A.	Investigative	[26]
[HO1][Thr4,Orn8(5/6C-Flu)]VT	DM81B4W	Discovery agent	N.A.	Investigative	[26]
[Lys8(Alexa 488) ]PVA	DM7STF6	Discovery agent	N.A.	Investigative	[29]
[Lys8(Alexa 546) ]PVA	DM38L6U	Discovery agent	N.A.	Investigative	[29]
[Phe3]OT	DMK18CS	Discovery agent	N.A.	Investigative	[37]
[Thr4,Gly7]OT	DM7QAKB	Discovery agent	N.A.	Investigative	[8]
[Val4]AVP	DMW82ZT	Discovery agent	N.A.	Investigative	[38]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Sepsis with septic shock	1G41	Whole blood	8.89E-04	-0.12	-0.34

References

• [1] Investigational vasopressin receptor modulators in the pipeline. Expert Opin Investig Drugs. 2009 Aug;18(8):1119-31.
• [2] Acute hemodynamic effects of conivaptan, a dual V(1A) and V(2) vasopressin receptor antagonist, in patients with advanced heart failure. Circulation. 2001 Nov 13;104(20):2417-23.
• [3] Conivaptan: a dual vasopressin receptor v1a/v2 antagonist [corrected]. Cardiovasc Drug Rev. 2007 Fall;25(3):261-79.
• [4] Design of potent and selective agonists for the human vasopressin V1b receptor based on modifications of [deamino-cys1]arginine vasopressin at position 4. J Med Chem. 2004 Apr 22;47(9):2375-88.
• [5] Peptide and non-peptide agonists and antagonists for the vasopressin and oxytocin V1a, V1b, V2 and OT receptors: research tools and potential therapeutic agents. Prog Brain Res. 2008;170:473-512.
• [6] Nonpeptide vasopressin antagonists: a new group of hormone blockers entering the scene. Exp Clin Endocrinol Diabetes. 1999;107(3):157-65.
• [7] New analgesic drugs derived from phencyclidine. J Med Chem. 1981 May;24(5):496-9.
• [8] Mapping peptide-binding domains of the human V1a vasopressin receptor with a photoactivatable linear peptide antagonist. J Biol Chem. 1997 Oct 17;272(42):26536-44.
• [9] The discovery of GSK221149A: a potent and selective oxytocin antagonist. Bioorg Med Chem Lett. 2008 Jan 1;18(1):90-4.
• [10] Discovery of Balovaptan, a Vasopressin 1a Receptor Antagonist for the Treatment of Autism Spectrum Disorder. J Med Chem. 2020 Feb 27;63(4):1511-1525.
• [11] The selective vasopressin type 1a receptor agonist selepressin (FE 202158) blocks vascular leak in ovine severe sepsis*. Crit Care Med. 2014 Jul;42(7):e525-33.
• [12] Peptidomimetic C5a receptor antagonists with hydrophobic substitutions at the C-terminus: increased receptor specificity and in vivo activity. Bioorg Med Chem Lett. 2006 Oct 1;16(19):5088-92.
• [13] Social Communication is an Emerging Target for Pharmacotherapy in Autism Spectrum Disorder - A Review of the Literature on Potential Agents. J Can Acad Child Adolesc Psychiatry. 2014 February; 23(1):20-30.
• [14] Pharmacokinetics and metabolism of SRX246: a potent and selective vasopressin 1a antagonist. J Pharm Sci. 2013 Jun;102(6):2033-43.
• [15] Safety and Tolerability of SRX246, a Vasopressin 1a Antagonist, in Irritable Huntington's Disease Patients-A Randomized Phase 2 Clinical Trial. J Clin Med. 2020 Nov 16;9(11):3682.
• [16] Tetrahydroquinoline sulfonamides as vasopressin 1b receptor antagonists. Bioorg Med Chem Lett. 2009 Nov 1;19(21):6018-22.
• [17] Clinical pipeline report, company report or official report of Avarx.
• [18] Orally active vasopressin V1a receptor antagonist, SRX251, selectively blocks aggressive behavior. Pharmacol Biochem Behav. 2006 Feb;83(2):169-74.
• [19] Vasopressin V1a and V1b receptor modulators: a patent review (2012 - 2014).Expert Opin Ther Pat. 2015 Jun;25(6):711-22.
• [20] A patent review of oxytocin receptor antagonists 2013-2017.Expert Opin Ther Pat. 2017 Dec;27(12):1287-1290.
• [21] Nonpeptide vasopressin receptor antagonists: development of selective and orally active V1a, V2 and V1b receptor ligands. Prog Brain Res. 2002;139:197-210.
• [22] Oral oxytocin antagonists. J Med Chem. 2010 Sep 23;53(18):6525-38.
• [23] Emerging drugs for acute and chronic heart failure: current and future developments. Expert Opin Emerg Drugs. 2007 Mar;12(1):75-95.
• [24] cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain... J Med Chem. 2008 Nov 27;51(22):7094-8.
• [25] Design and synthesis of the first selective agonists for the rat vasopressin V(1b) receptor: based on modifications of deamino-[Cys1]arginine vasop... J Med Chem. 2007 Feb 22;50(4):835-47.
• [26] Synthesis and characterization of fluorescent antagonists and agonists for human oxytocin and vasopressin V(1)(a) receptors. J Med Chem. 2002 Jun 6;45(12):2579-88.
• [27] Conserved aromatic residues in the transmembrane region VI of the V1a vasopressin receptor differentiate agonist vs. antagonist ligand binding. Eur J Biochem. 2000 Jul;267(13):4253-63.
• [28] Pharmacological characterization of the human vasopressin receptor subtypes stably expressed in Chinese hamster ovary cells. Br J Pharmacol. 1998 Dec;125(7):1463-70.
• [29] Toward efficient drug screening by homogeneous assays based on the development of new fluorescent vasopressin and oxytocin receptor ligands. J Med Chem. 2007 Oct 4;50(20):4976-85.
• [30] Discovery and development of a new class of potent, selective, orally active oxytocin receptor antagonists. J Med Chem. 2005 Dec 1;48(24):7882-905.
• [31] Pharmacology of (2S,4Z)-N-[(2S)-2-hydroxy-2-phenylethyl]-4-(methoxyimino) -1-[(2'-methyl[1,1'-biphenyl]-4-yl)carbonyl]-2-pyrrolidinecarboxamide, a ... J Pharmacol Exp Ther. 2003 Jul;306(1):253-61.
• [32] Binding of [3H] SR 49059, a potent nonpeptide vasopressin V1a antagonist, to rat and human liver membranes. Biochem Biophys Res Commun. 1994 Feb 28;199(1):353-60.
• [33] SSR126768A (4-chloro-3-[(3R)-(+)-5-chloro-1-(2,4-dimethoxybenzyl)-3-methyl-2-oxo-2,3-dihydro-1H-indol-3-yl]-N-ethyl-N-(3-pyridylmethyl)-benzamide, ... J Pharmacol Exp Ther. 2004 Apr;309(1):414-24.
• [34] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 366).
• [35] Effects of YM218, a nonpeptide vasopressin V1A receptor-selective antagonist, on human vasopressin and oxytocin receptors. Pharmacol Res. 2005 Mar;51(3):275-81.
• [36] Effects of YM471, a nonpeptide AVP V(1A) and V(2) receptor antagonist, on human AVP receptor subtypes expressed in CHO cells and oxytocin receptors in human uterine smooth muscle cells. Br J Pharmacol. 2001 Jul;133(5):746-54.
• [37] Tyr115 is the key residue for determining agonist selectivity in the V1a vasopressin receptor. EMBO J. 1995 May 15;14(10):2176-82.
• [38] [1-deamino-4-cyclohexylalanine] arginine vasopressin: a potent and specific agonist for vasopressin V1b receptors. Endocrinology. 2002 Dec;143(12):4655-64.