Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT9JNIC)

• DTT Name: Histamine H3 receptor (H3R)
• Synonyms: Histamine receptor 3; HH3R; GPCR97; G-protein coupled receptor 97; G protein-coupled receptor 97
• Gene Name: HRH3
• DTT Type: Successful target; [1]
• BioChemical Class: GPCR rhodopsin
• UniProt ID: HRH3_HUMAN
• TTD ID: T64765
• Sequence:
  MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
  ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS
  SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG
  SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA
  GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV
  ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL
  AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR
  RAFTKLLCPQKLKIQPHSSLEHCWK
• Function: Signals through the inhibition of adenylate cyclase and displays high constitutive activity (spontaneous activity in the absence of agonist). Agonist stimulation of isoform 3 neither modified adenylate cyclase activity nor induced intracellular calcium mobilization. The H3 subclass of histamine receptors could mediate the histamine signals in CNS and peripheral nervous system.
• KEGG Pathway: Neuroactive ligand-receptor interaction (hsa04080)
• Reactome Pathway:
  G alpha (i) signalling events (R-HSA-418594)
  Histamine receptors (R-HSA-390650)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Pitolisant	DM8RFNJ	Excessive daytime sleepiness	MG42	Approved	[2]

17 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
SUVN-G3031	DM3BO8G	Cognitive impairment	6D71	Phase 3	[3]
ABT-288	DM7X54F	Alzheimer disease	8A20	Phase 2	[4]
ABT-652	DMLEO2Z	Diabetic neuropathy	8C0Z	Phase 2	[5]
AZD-5213	DMOZ04X	Alzheimer disease	8A20	Phase 2	[6]
Bavisant	DM6CVZ5	Attention deficit hyperactivity disorder	6A05.Z	Phase 2	[7]
GSK239512	DMBJMZC	Alzheimer disease	8A20	Phase 2	[8]
JNJ-17216498	DM1GRCU	Narcolepsy	7A20	Phase 2	[9]
JNJ-39220675	DM0WY3H	Alcohol dependence	6C40.2	Phase 2	[10]
S-38093	DMD8XOY	Alzheimer disease	8A20	Phase 2	[11]
SAR-110894	DMCLEXM	Alzheimer disease	8A20	Phase 2	[6]
ABT-239	DMR7OGL	Cognitive impairment	6D71	Phase 1	[12]
APD-916	DMRGF9Q	Sleep-wake disorder	7A00-7B2Z	Phase 1	[13]
HPP404	DMUEZ7V	Allergic rhinitis	CA08.0	Phase 1	[14]
Irdabisant	DMR3E4L	Cognitive impairment	6D71	Phase 1	[15]
MK-3134	DM5EFPS	Dementia	6D80-6D86	Phase 1	[16]
MK-7288	DMJ2Q6H	Excessive daytime sleepiness	MG42	Phase 1	[17]
MK-0249	DMAPV6J	Insulin-resistant disorder	5A44	Clinical trial	[18]

41 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
4-benzylidene-1-(cyclobutylo)piperidine derivative 1	DMZDUNT	N. A.	N. A.	Patented	[19]
Acrylamide compound 1	DMO4YAB	N. A.	N. A.	Patented	[19]
Acrylamide compound 2	DM7EOG4	N. A.	N. A.	Patented	[19]
Acrylamide compound 3	DM7JARB	N. A.	N. A.	Patented	[19]
Acrylamide compound 4	DMZL6D8	N. A.	N. A.	Patented	[19]
Benzo[d]oxazol-2(3H)-one derivative 1	DMKXD2V	N. A.	N. A.	Patented	[19]
Benzo[d]oxazol-2(3H)-one derivative 2	DM47KWB	N. A.	N. A.	Patented	[19]
Benzo[d]oxazol-2(3H)-one derivative 3	DM3Z5UQ	N. A.	N. A.	Patented	[19]
Biphenyl derivative 4	DMIPVYW	Histamine H3-associated disorder	NE61	Patented	[19]
Phenoxypiperidine derivative 1	DM0PBJT	N. A.	N. A.	Patented	[19]
Phenoxypiperidine derivative 2	DMC5G8P	N. A.	N. A.	Patented	[19]
Phenylsulfonyl derivative 1	DM9NOP3	Central nervous system disease	8A04-8D87	Patented	[19]
Phenylsulfonyl derivative 2	DM63128	Central nervous system disease	8A04-8D87	Patented	[19]
Phenylsulfonyl derivative 3	DME6FLN	Central nervous system disease	8A04-8D87	Patented	[19]
Phenylsulfonyl derivative 4	DM1HYW4	Central nervous system disease	8A04-8D87	Patented	[19]
Piperazine carbamate/urea derivative 1	DMCIXD4	N. A.	N. A.	Patented	[19]
Piperazine carbamate/urea derivative 2	DMCG6BE	N. A.	N. A.	Patented	[19]
Piperazine carbamate/urea derivative 3	DM2R468	N. A.	N. A.	Patented	[19]
Piperazine carbamate/urea derivative 4	DM75J4T	N. A.	N. A.	Patented	[19]
Piperazine carbamate/urea derivative 5	DMJ80IZ	N. A.	N. A.	Patented	[19]
Piperazine carbamate/urea derivative 6	DMZEPU3	N. A.	N. A.	Patented	[19]
Piperazine carbamate/urea derivative 7	DM067UC	N. A.	N. A.	Patented	[19]
Piperidine derivative 1	DMHN5KW	N. A.	N. A.	Patented	[19]
PMID29334795-Compound-21	DMTOA1Q	Corticobasal degeneration	8A00.1Y	Patented	[19]
PMID29334795-Compound-22	DM8N10A	Alzheimer disease	8A20	Patented	[19]
PMID29334795-Compound-23	DM3VL64	Schizophrenia	6A20	Patented	[19]
PMID29334795-Compound-24	DMTUQV0	N. A.	N. A.	Patented	[19]
PMID29334795-Compound-25	DMGEWVP	N. A.	N. A.	Patented	[19]
PMID29334795-Compound-28	DM1SWYU	Histamine H3-associated disorder	NE61	Patented	[19]
PMID29334795-Compound-55	DMM30LJ	N. A.	N. A.	Patented	[19]
PMID29334795-Compound-56	DMS9Q3U	N. A.	N. A.	Patented	[19]
PMID29334795-Compound-57	DMGO1PA	N. A.	N. A.	Patented	[19]
PMID29334795-Compound-58	DMB8GHJ	N. A.	N. A.	Patented	[19]
PMID29334795-Compound-61	DM9H3LI	N. A.	N. A.	Patented	[19]
PMID29334795-Compound-62	DMKAFPC	N. A.	N. A.	Patented	[19]
PMID29334795-Compound-66	DMQOF53	N. A.	N. A.	Patented	[19]
PMID29334795-Compound-67	DMC95N7	N. A.	N. A.	Patented	[19]
Pyridazin-3(2H)-one derivative 1	DMKJ3PC	N. A.	N. A.	Patented	[19]
Steroidal carboxamide derivative 1	DMHLA5V	N. A.	N. A.	Patented	[19]
Triazolo-benzodiazepine derivative 1	DM79KEX	N. A.	N. A.	Patented	[19]
Triazolo-benzodiazepine derivative 2	DMQSCHA	N. A.	N. A.	Patented	[19]

10 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
BP-2.94	DMI3T64	Pain	MG30-MG3Z	Discontinued in Phase 2	[20]
Cipralisant	DMTAKNF	Attention deficit hyperactivity disorder	6A05.Z	Discontinued in Phase 2	[21]
GSK835726	DMRNJPY	Allergic rhinitis	CA08.0	Discontinued in Phase 2	[8]
GSK1004723	DMEC6RD	Allergic rhinitis	CA08.0	Discontinued in Phase 1	[8]
SAR-152954	DM7OR48	Sleep-wake disorder	7A00-7B2Z	Discontinued in Phase 1	[22]
GR-175737	DMOY8UA	N. A.	N. A.	Terminated	[23]
GT-2016	DM42XHS	Alzheimer disease	8A20	Terminated	[23]
GT-2203	DMJ4PNR	Anxiety disorder	6B00-6B0Z	Terminated	[24]
Thioperamide	DM8S593	Cognitive impairment	6D71	Terminated	[25]
UCL-1390	DMD3CA5	Eating disorder	6B82	Terminated	[26]

146 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(1H-indol-2-yl)(piperazin-1-yl)methanone	DMW15DS	Discovery agent	N.A.	Investigative	[27]
(1R,2R)-2-(1H-Imidazol-4-yl)-1-methyl-propylamine	DM5ROS1	Discovery agent	N.A.	Investigative	[28]
(1R,2S)-2-(1H-Imidazol-4-yl)-1-methyl-propylamine	DMZ3DMX	Discovery agent	N.A.	Investigative	[28]
(1S,2S)-2-(1H-Imidazol-4-yl)-cyclopentylamine	DMZCS2K	Discovery agent	N.A.	Investigative	[28]
(R)-1-(2-methoxyphenethyl)-2-methylpyrrolidine	DMMY0NF	Discovery agent	N.A.	Investigative	[29]
(R)-1-(3-methoxyphenethyl)-2-methylpyrrolidine	DM76SZK	Discovery agent	N.A.	Investigative	[29]
(R)-1-(4-methoxyphenethyl)-2-methylpyrrolidine	DMR3DSG	Discovery agent	N.A.	Investigative	[29]
(R)-1-(4-nitrophenethyl)-2-methylpyrrolidine	DMNROUV	Discovery agent	N.A.	Investigative	[29]
(R)-2-(2-(2-methylpyrrolidin-1-yl)ethyl)phenol	DMFDW4C	Discovery agent	N.A.	Investigative	[29]
(R)-2-(2-(2-methylpyrrolidin-1-yl)ethyl)pyridine	DM0L6ES	Discovery agent	N.A.	Investigative	[29]
(R)-2-methyl-1-(2-m-tolyl-ethyl)-pyrrolidine	DMT8HP1	Discovery agent	N.A.	Investigative	[29]
(R)-2-methyl-1-(2-p-tolyl-ethyl)-pyrrolidine	DMA1FUH	Discovery agent	N.A.	Investigative	[29]
(R)-3-(1H-imidazol-4-yl)propyl sec-butylcarbamate	DMCSHI3	Discovery agent	N.A.	Investigative	[30]
(R)-3-(2-(2-methylpyrrolidin-1-yl)ethyl)pyridine	DMUFP7W	Discovery agent	N.A.	Investigative	[29]
(R)-4-(2-(2-methylpyrrolidin-1-yl)ethyl)pyridine	DM5CL8B	Discovery agent	N.A.	Investigative	[29]
(R)-6-(2-(2-methylpyrrolidin-1-yl)ethyl)quinoline	DM3LQFK	Discovery agent	N.A.	Investigative	[31]
(R)-alpha-methylhistamine	DMKAW4P	Discovery agent	N.A.	Investigative	[25]
(S)-1-(2-methoxyphenethyl)-2-methylpyrrolidine	DMF9YLR	Discovery agent	N.A.	Investigative	[29]
(S)-1-(3-methoxyphenethyl)-2-methylpyrrolidine	DM8UWT9	Discovery agent	N.A.	Investigative	[29]
(S)-1-(4-methoxyphenethyl)-2-methylpyrrolidine	DMDBHY1	Discovery agent	N.A.	Investigative	[29]
(S)-1-(4-nitrophenethyl)-2-methylpyrrolidine	DMG7XL5	Discovery agent	N.A.	Investigative	[29]
(S)-2-(2-(2-methylpyrrolidin-1-yl)ethyl)phenol	DMQGCKX	Discovery agent	N.A.	Investigative	[29]
(S)-2-(2-(2-methylpyrrolidin-1-yl)ethyl)pyridine	DMVKL84	Discovery agent	N.A.	Investigative	[29]
(S)-2-methyl-1-(2-m-tolyl-ethyl)-pyrrolidine	DMQGCM3	Discovery agent	N.A.	Investigative	[29]
(S)-2-methyl-1-(2-p-tolyl-ethyl)-pyrrolidine	DMJFI75	Discovery agent	N.A.	Investigative	[29]
(S)-3-(1H-imidazol-4-yl)propyl sec-butylcarbamate	DM435QN	Discovery agent	N.A.	Investigative	[30]
(S)-4-(2-(2-methylpyrrolidin-1-yl)ethyl)pyridine	DMLZBJT	Discovery agent	N.A.	Investigative	[29]
(S)-alpha-methylhistamine	DMTUZIN	Discovery agent	N.A.	Investigative	[32]
1-(2-(naphthalen-2-yl)ethyl)pyrrolidine	DMYFKID	Discovery agent	N.A.	Investigative	[29]
1-(2-m-tolyl-ethyl)-pyrrolidine	DMKITY6	Discovery agent	N.A.	Investigative	[29]
1-(2-methoxyphenethyl)pyrrolidine	DMDQVSU	Discovery agent	N.A.	Investigative	[29]
1-(2-p-tolyl-ethyl)-pyrrolidine	DMDLKPI	Discovery agent	N.A.	Investigative	[29]
1-(3-(2-(3-methoxyphenoxy)ethoxy)propyl)azepane	DMEDSLZ	Discovery agent	N.A.	Investigative	[33]
1-(3-(3-phenylpropoxy)propyl)piperidine	DM3EYOL	Discovery agent	N.A.	Investigative	[34]
1-(3-(4-(2-fluoroethyl)phenoxy)propyl)piperidine	DMHEIKQ	Discovery agent	N.A.	Investigative	[35]
1-(3-(4-(fluoromethyl)phenoxy)propyl)piperidine	DMVXCPE	Discovery agent	N.A.	Investigative	[35]
1-(3-methoxyphenethyl)pyrrolidine	DMGU7MO	Discovery agent	N.A.	Investigative	[29]
1-(4-(benzyloxy)phenethyl)pyrrolidine	DMT3H0K	Discovery agent	N.A.	Investigative	[29]
1-(4-methoxyphenethyl)pyrrolidine	DMAW78K	Discovery agent	N.A.	Investigative	[29]
1-(4-nitrophenethyl)pyrrolidine	DMKR8BI	Discovery agent	N.A.	Investigative	[29]
1-[2-(2,4,6-trimethyl-phenyl)-ethyl]-pyrrolidine	DMEHP8M	Discovery agent	N.A.	Investigative	[29]
2-((1H-imidazol-4-yl)methyl)pyridine	DM1TK45	Discovery agent	N.A.	Investigative	[36]
2-((2-ethoxyphenoxy)methyl)-4-isopropylmorpholine	DM91PA5	Discovery agent	N.A.	Investigative	[37]
2-(1,4'-bipiperidin-1'-yl)thiazolo[4,5-b]pyridine	DMZ83G9	Discovery agent	N.A.	Investigative	[38]
2-(1,4'-bipiperidin-1'-yl)thiazolo[4,5-c]pyridine	DMEKSAZ	Discovery agent	N.A.	Investigative	[38]
2-(2-(4-tert-Butylphenylthio)ethyl)-1H-imidazole	DMZVBPG	Discovery agent	N.A.	Investigative	[36]
2-(2-(pyrrolidin-1-yl)ethyl)-1H-indole	DMCHZ8J	Discovery agent	N.A.	Investigative	[29]
2-(2-(pyrrolidin-1-yl)ethyl)phenol	DMQ0WKA	Discovery agent	N.A.	Investigative	[29]
2-(2-(pyrrolidin-1-yl)ethyl)pyridine	DMGQC2F	Discovery agent	N.A.	Investigative	[29]
2-(3-Methyl-3H-imidazol-4-yl)-ethylamine	DME09J2	Discovery agent	N.A.	Investigative	[23]
2-(4-Cyclopentyl-piperazin-1-yl)-quinoline	DM6VQEO	Discovery agent	N.A.	Investigative	[39]
2-(4-Cyclopropyl-piperazin-1-yl)-quinoline	DMPU90E	Discovery agent	N.A.	Investigative	[39]
2-(4-Isopropyl-piperazin-1-yl)-quinoline	DMSH4WP	Discovery agent	N.A.	Investigative	[39]
2-(4-Methyl-piperazin-1-yl)-quinoline	DMB8OY6	Discovery agent	N.A.	Investigative	[39]
2-(4-Propyl-piperazin-1-yl)-quinoline	DMWPM9L	Discovery agent	N.A.	Investigative	[39]
2-(ethoxycarbonyl)-1H-indole-5-carboxylic acid	DMS7WQD	Discovery agent	N.A.	Investigative	[40]
2-[2-(1H-Imidazol-4-yl)-cyclopropyl]-ethylamine	DMKEZ5G	Discovery agent	N.A.	Investigative	[41]
2-[4-(1-Ethyl-propyl)-piperazin-1-yl]-quinoline	DMUH526	Discovery agent	N.A.	Investigative	[39]
3-((1H-imidazol-4-yl)methyl)pyridine	DMJ6O43	Discovery agent	N.A.	Investigative	[36]
4-((1H-imidazol-4-yl)methyl)-1-heptylpiperidine	DMX2QD5	Discovery agent	N.A.	Investigative	[42]
4-((1H-Imidazol-4-yl)methyl)-1-phenylpiperidine	DMRYWSN	Discovery agent	N.A.	Investigative	[43]
4-((2R,3S)-2-Methyl-pyrrolidin-3-yl)-1H-imidazole	DMJN2OW	Discovery agent	N.A.	Investigative	[28]
4-((2S,3R)-2-Methyl-pyrrolidin-3-yl)-1H-imidazole	DM8WCJK	Discovery agent	N.A.	Investigative	[28]
4-(2-(3,4-Dimethylphenylamino)ethyl)-1H-imidazole	DMKZ6JW	Discovery agent	N.A.	Investigative	[44]
4-(2-(3-tert-Butylphenylamino)ethyl)-1H-imidazole	DMP1LY4	Discovery agent	N.A.	Investigative	[44]
4-(2-(4-Cyclohexylphenylamino)ethyl)-1H-imidazole	DMM8CU2	Discovery agent	N.A.	Investigative	[44]
4-(2-(4-Methoxyphenylamino)ethyl)-1H-imidazole	DMFCS8G	Discovery agent	N.A.	Investigative	[44]
4-(2-(4-Methylphenylamino)ethyl)-1H-imidazole	DMYM72T	Discovery agent	N.A.	Investigative	[44]
4-(2-(4-tert-Butylphenylamino)ethyl)-1H-imidazole	DMK8ROX	Discovery agent	N.A.	Investigative	[44]
4-(2-(Cyclohexylamino)ethyl)-1H-imidazole	DM1MP96	Discovery agent	N.A.	Investigative	[44]
4-(2-(Phenylamino)ethyl)-1H-imidazole	DMX1HKU	Discovery agent	N.A.	Investigative	[44]
4-(2-(pyrrolidin-1-yl)ethyl)pyridine	DMHWD2C	Discovery agent	N.A.	Investigative	[29]
4-(3-Phenoxy-propyl)-1H-imidazole	DM5F13I	Discovery agent	N.A.	Investigative	[45]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one	DMM9X0G	Discovery agent	N.A.	Investigative	[46]
4-(6-Cyclohexyl-hex-3-ynyl)-1H-imidazole	DMPD9GE	Discovery agent	N.A.	Investigative	[23]
4-(6-Cyclopentyl-hex-3-ynyl)-1H-imidazole	DM4EC0J	Discovery agent	N.A.	Investigative	[23]
4-(7,7-Dimethyl-oct-3-ynyl)-1H-imidazole	DMIY5QU	Discovery agent	N.A.	Investigative	[23]
4-(7-Methyl-oct-3-ynyl)-1H-imidazole	DMJ86OS	Discovery agent	N.A.	Investigative	[23]
4-(8-Phenyl-oct-3-ynyl)-1H-imidazole	DM27OGL	Discovery agent	N.A.	Investigative	[23]
4-Benzyl-1-[3-phenylpropoxy)propyl]piperidine	DMIX6RG	Discovery agent	N.A.	Investigative	[34]
4-Butyl-1-[3-(phenylpropoxy)propyl]piperidine	DM6ADJM	Discovery agent	N.A.	Investigative	[34]
4-Hept-3-ynyl-1H-imidazole	DM5MHO6	Discovery agent	N.A.	Investigative	[23]
4-Hex-3-ynyl-1H-imidazole	DMYNTJ0	Discovery agent	N.A.	Investigative	[23]
4-isopropyl-2-(phenoxymethyl)morpholine	DM7F38J	Discovery agent	N.A.	Investigative	[37]
4-Propyl-1-[3-(phenylpropoxy)propyl]piperidine	DMDBC1K	Discovery agent	N.A.	Investigative	[34]
4-[3-(4-Butyl-phenoxy)-propyl]-1H-imidazole	DMFKRMG	Discovery agent	N.A.	Investigative	[47]
4-[3-(4-Ethynyl-phenoxy)-propyl]-1H-imidazole	DMXBEYQ	Discovery agent	N.A.	Investigative	[47]
4-[3-(4-Methoxy-phenoxy)-propyl]-1H-imidazole	DM4GU29	Discovery agent	N.A.	Investigative	[45]
5-(2-(pyrrolidin-1-yl)ethyl)isothiazole	DMXAF7Y	Discovery agent	N.A.	Investigative	[29]
5-ethyl-2-(2-(pyrrolidin-1-yl)ethyl)pyridine	DMX64E3	Discovery agent	N.A.	Investigative	[29]
5-methoxy-2-(2-(pyrrolidin-1-yl)ethyl)-1H-indole	DMX1LY3	Discovery agent	N.A.	Investigative	[29]
5-phenyl-2-(4-(piperidin-1-yl)butyl)oxazole	DMQHU0J	Discovery agent	N.A.	Investigative	[48]
A-304121	DMPI0YX	Discovery agent	N.A.	Investigative	[49]
A-317920	DM124K5	Attention deficit hyperactivity disorder	6A05.Z	Investigative	[25]
A-331440	DMPU3QR	Obesity	5B81	Investigative	[25]
Aerophobin-1	DME0I6U	Discovery agent	N.A.	Investigative	[50]
APLYSAMINE	DM6NM8V	Discovery agent	N.A.	Investigative	[51]
ATH-90879	DMSNBMQ	Obesity	5B81	Investigative	[24]
burimamide	DMZ2VYG	Discovery agent	N.A.	Investigative	[52]
C-[2-(1H-Imidazol-4-yl)-cyclopropyl]-methylamine	DMY2NU8	Discovery agent	N.A.	Investigative	[41]
CARCININE	DMQUKBG	Discovery agent	N.A.	Investigative	[51]
Ciproxifan	DM9N8WM	Dementia	6D80-6D86	Investigative	[25]
Clobenpropit	DM537OH	Discovery agent	N.A.	Investigative	[25]
CONESSINE	DM4VYP0	Discovery agent	N.A.	Investigative	[53]
Des-bromoaplysamine-1	DMIKUBY	Discovery agent	N.A.	Investigative	[54]
EVT-501	DM4Q2HZ	Sleep-wake disorder	7A00-7B2Z	Investigative	[24]
FUB 349	DMUAYWX	Discovery agent	N.A.	Investigative	[55]
FUB-130	DMCLSE0	Neurological disorder	6B60	Investigative	[24]
GSK-334429	DM5EO3F	Cognitive impairment	6D71	Investigative	[24]
GSK189254A	DMKXPOL	Cognitive impairment	6D71	Investigative	[25]
GT2394	DMH3PDG	Discovery agent	N.A.	Investigative	[32]
imbutamine	DMPKWUO	Discovery agent	N.A.	Investigative	[56]
Imetit	DMMJ6NS	Discovery agent	N.A.	Investigative	[25]
Immepip	DMDM3Y1	Discovery agent	N.A.	Investigative	[25]
Immethridine	DM7YQ26	Discovery agent	N.A.	Investigative	[25]
impentamine	DMPJXZN	Discovery agent	N.A.	Investigative	[56]
impromidine	DMTDRPM	Discovery agent	N.A.	Investigative	[52]
IODOPROXYFAN	DMDA6VL	Discovery agent	N.A.	Investigative	[45]
JB 98064	DMPRTVX	Discovery agent	N.A.	Investigative	[32]
JNJ-28583867	DM5LEOR	Discovery agent	N.A.	Investigative	[57]
JNJ-5207852	DM5L23N	Narcolepsy	7A20	Investigative	[25]
Methimepip	DMVQSEH	Discovery agent	N.A.	Investigative	[25]
N-benzyl-4-cyclopentylpiperazine-1-carboxamide	DMUFR62	Discovery agent	N.A.	Investigative	[58]
N-methyl-2-(pyridin-2-yl)ethanamine	DM8LNMY	Discovery agent	N.A.	Investigative	[40]
N-methylhistamine	DMCFH5W	Discovery agent	N.A.	Investigative	[52]
N-[3H]alpha-methylhistamine	DMWDCV1	Discovery agent	N.A.	Investigative	[59]
N-[3H]methylhistamine	DM0CI4L	Discovery agent	N.A.	Investigative	[52]
PF-3900422	DM7E391	Central nervous system disease	8A04-8D87	Investigative	[24]
Proxyfan	DM72AT8	Discovery agent	N.A.	Investigative	[25]
SCH79687	DM5ZEPD	Central nervous system disease	8A04-8D87	Investigative	[25]
ST-1025	DM14PLC	Discovery agent	N.A.	Investigative	[48]
ST-1093	DMKZJWV	Discovery agent	N.A.	Investigative	[48]
SUVN-G1031	DMVDHBT	Metabolic disorder	5C50-5D2Z	Investigative	[24]
UCB-2892	DMQ20A4	Cognitive impairment	6D71	Investigative	[24]
UCL-2138	DM15CJZ	Discovery agent	N.A.	Investigative	[35]
UCL1972	DM0P5Z9	Discovery agent	N.A.	Investigative	[25]
Verongamine	DMD1C6S	Discovery agent	N.A.	Investigative	[50]
VUF 4904	DMFPNRD	Discovery agent	N.A.	Investigative	[60]
VUF 5207	DMMNVGJ	Discovery agent	N.A.	Investigative	[60]
VUF 5681	DMVFJR4	Discovery agent	N.A.	Investigative	[25]
VUF 8328	DMI6GD0	Discovery agent	N.A.	Investigative	[60]
VUF-10214	DMADEOQ	Discovery agent	N.A.	Investigative	[61]
VUF-5297	DM3G6OK	Discovery agent	N.A.	Investigative	[41]
VUF5391	DMF1O0Z	Discovery agent	N.A.	Investigative	[25]
[123I]iodoproxyfan	DM5SRT1	Discovery agent	N.A.	Investigative	[55]
[125I]iodophenpropit	DMN4ABU	Discovery agent	N.A.	Investigative	[62]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Schizophrenia	6A20	Pre-frontal cortex	2.63E-01	0.06	0.23
Schizophrenia	6A20	Superior temporal cortex	6.11E-01	-0.08	-0.69
Alzheimer's disease	8A00.0	Entorhinal cortex	3.62E-02	-0.09	-0.22

References

• [1] Effects of pitolisant, a histamine H3 inverse agonist, in drug-resistant idiopathic and symptomatic hypersomnia: a chart review. Sleep Med. 2014 Jun;15(6):681-7.
• [2] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019
• [3] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [4] A randomized study of H3 antagonist ABT-288 in mild-to-moderate Alzheimer's dementia.J Alzheimers Dis.2014;42(3):959-71.
• [5] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032225)
• [6] SAR110894, a potent histamine H receptor antagonist, displays procognitive effects in rodents. Pharmacol Biochem Behav. 2012 Aug;102(2):203-14.
• [7] Randomized clinical study of a histamine H3 receptor antagonist for the treatment of adults with attention-deficit hyperactivity disorder. CNS Drugs. 2012 May 1;26(5):421-34.
• [8] Clinical pipeline report, company report or official report of GlaxoSmithKline (2009).
• [9] Acute wake-promoting actions of JNJ-5207852, a novel, diamine-based H3 antagonist. Br J Pharmacol. 2004 Nov;143(5):649-61.
• [10] JNJ-39220675, a novel selective histamine H3 receptor antagonist, reduces the abuse-related effects of alcohol in rats. Psychopharmacology (Berl). 2011 Apr;214(4):829-41.
• [11] Histamine H3 Receptors and Sleep-Wake Regulation. JPET January 2011 vol. 336 no. 1 17-23.
• [12] Use of the H3 receptor antagonist radioligand [3H]-A-349821 to reveal in vivo receptor occupancy of cognition enhancing H3 receptor antagonists. Br J Pharmacol. 2009 May;157(1):139-49.
• [13] Identification of biaryl sulfone derivatives as antagonists of the histamine H receptor: discovery of (R)-1-(2-(4'-(3-methoxypropylsulfonyl)biphenyl-4-yl)ethyl)-2-methylpyrrolidine (APD916). Bioorg Med Chem Lett. 2012 Jan 1;22(1):71-5.
• [14] Clinical pipeline report, company report or official report of TransTech Pharma (2011).
• [15] CEP-26401 (irdabisant), a potent and selective histamine H receptor antagonist/inverse agonist with cognition-enhancing and wake-promoting activities. J Pharmacol Exp Ther. 2012 Jan;340(1):124-33.
• [16] Additive effects of a cholinesterase inhibitor and a histamine inverse agonist on scopolamine deficits in humans. Psychopharmacology (Berl). 2011 Dec;218(3):513-24.
• [17] Early-stage comparative effectiveness: randomized controlled trial with histamine inverse agonist MK-7288 in excessive daytime sleepiness patients. J Clin Pharmacol. 2013 Dec;53(12):1294-302.
• [18] Synthesis, structure-activity relationships, and biological profiles of a quinazolinone class of histamine H3 receptor inverse agonists. J Med Chem. 2008 Aug 14;51(15):4780-9.
• [19] Progress in the development of histamine H3 receptor antagonists/inverse agonists: a patent review (2013-2017).Expert Opin Ther Pat. 2018 Mar;28(3):175-196.
• [20] Sleep and waking during acute histamine H3 agonist BP 2.94 or H3 antagonist carboperamide (MR 16155) administration in rats. Neuropsychopharmacology. 1996 Jul;15(1):31-5.
• [21] G protein-dependent pharmacology of histamine H3 receptor ligands: evidence for heterogeneous active state receptor conformations. J Pharmacol Exp Ther. 2005 Jul;314(1):271-81.
• [22] Clinical pipeline report, company report or official report of Sanofi.
• [23] New acetylene based histamine H3 receptor antagonists derived from the marine natural product verongamine. Bioorg Med Chem Lett. 1998 May 19;8(10):1133-8.
• [24] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 264).
• [25] The histamine H3 receptor: from gene cloning to H3 receptor drugs. Nat Rev Drug Discov. 2005 Feb;4(2):107-20.
• [26] Emerging drugs for eating disorder treatment. Expert Opin Emerg Drugs. 2006 May;11(2):315-36.
• [27] Preparation and biological evaluation of indole, benzimidazole, and thienopyrrole piperazine carboxamides: potent human histamine h(4) antagonists. J Med Chem. 2005 Dec 29;48(26):8289-98.
• [28] A novel pyrrolidine analog of histamine as a potent, highly selective histamine H3 receptor agonist. J Med Chem. 1995 May 12;38(10):1593-9.
• [29] In vitro SAR of pyrrolidine-containing histamine H3 receptor antagonists: trends across multiple chemical series. Bioorg Med Chem Lett. 2008 Jan 1;18(1):355-9.
• [30] Histamine H3 and H4 receptor affinity of branched 3-(1H-imidazol-4-yl)propyl N-alkylcarbamates. Bioorg Med Chem Lett. 2009 Dec 1;19(23):6682-5.
• [31] In vitro studies on a class of quinoline containing histamine H3 antagonists. Bioorg Med Chem Lett. 2010 Jun 1;20(11):3295-300.
• [32] Characteristics of recombinantly expressed rat and human histamine H3 receptors. Eur J Pharmacol. 2002 Oct 18;453(1):33-41.
• [33] Diether derivatives of homo- or substituted piperidines as non-imidazole histamine H3 receptor ligands. Bioorg Med Chem. 2009 Apr 15;17(8):3037-42.
• [34] Piperidine variations in search for non-imidazole histamine H(3) receptor ligands. Bioorg Med Chem. 2008 Sep 15;16(18):8729-36.
• [35] Fluorinated non-imidazole histamine H3 receptor antagonists. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2172-5.
• [36] Investigation of the histamine H3 receptor binding site. Design and synthesis of hybrid agonists with a lipophilic side chain. J Med Chem. 2010 Sep 9;53(17):6445-56.
• [37] 2-Aryloxymethylmorpholine histamine H(3) antagonists. Bioorg Med Chem Lett. 2008 Nov 1;18(21):5796-9.
• [38] Synthesis and structure-activity relationships of 2-(1,4'-bipiperidin-1'-yl)thiazolopyridine as H3 receptor antagonists. Bioorg Med Chem Lett. 2009 Nov 1;19(21):6176-80.
• [39] 2-(4-alkylpiperazin-1-yl)quinolines as a new class of imidazole-free histamine H3 receptor antagonists. J Med Chem. 2005 Jan 13;48(1):306-11.
• [40] 5-hydroxyindole-2-carboxylic acid amides: novel histamine-3 receptor inverse agonists for the treatment of obesity. J Med Chem. 2009 Jul 9;52(13):3855-68.
• [41] Cyclopropane-based conformational restriction of histamine. (1S,2S)-2-(2-aminoethyl)-1-(1H-imidazol-4-yl)cyclopropane, a highly selective agonist f... J Med Chem. 2003 May 8;46(10):1980-8.
• [42] Novel histamine H3 receptor antagonists based on the 4-[(1H-imidazol-4-yl)methyl]piperidine scaffold. Bioorg Med Chem Lett. 2006 Jan 15;16(2):395-9.
• [43] Synthesis and structure-activity relationships of N-aryl-piperidine derivatives as potent (partial) agonists for human histamine H3 receptor. Bioorg Med Chem. 2010 Jul 15;18(14):5441-8.
• [44] Role of hydrophobic substituents on the terminal nitrogen of histamine in receptor binding and agonist activity: development of an orally active hi... J Med Chem. 2010 May 13;53(9):3840-4.
• [45] Different antagonist binding properties of human and rat histamine H3 receptors. Bioorg Med Chem Lett. 2001 Apr 9;11(7):951-4.
• [46] Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97.
• [47] Analogues and derivatives of ciproxifan, a novel prototype for generating potent histamine H3-receptor antagonists. Bioorg Med Chem Lett. 2000 Oct 16;10(20):2379-82.
• [48] Azole derivatives as histamine H3 receptor antagonists, part 2: C-C and C-S coupled heterocycles. Bioorg Med Chem Lett. 2010 Oct 1;20(19):5883-6.
• [49] Pharmacological and behavioral properties of A-349821, a selective and potent human histamine H3 receptor antagonist. Biochem Pharmacol. 2004 Sep 1;68(5):933-45.
• [50] Verongamine, a novel bromotyrosine-derived histamine H3-antagonist from the marine sponge Verongula gigantea. J Nat Prod. 1994 Jan;57(1):175-7.
• [51] The alkaloid conessine and analogues as potent histamine H3 receptor antagonists. J Med Chem. 2008 Sep 11;51(17):5423-30.
• [52] Cloning and pharmacological characterization of a fourth histamine receptor (H(4)) expressed in bone marrow. Mol Pharmacol. 2001 Mar;59(3):420-6.
• [53] Design of a new histamine H3 receptor antagonist chemotype: (3aR,6aR)-5-alkyl-1-aryl-octahydropyrrolo[3,4-b]pyrroles, synthesis, and structure-acti... J Med Chem. 2009 Aug 13;52(15):4640-9.
• [54] Aplysamine-1 and related analogs as histamine H3 receptor antagonists. Bioorg Med Chem Lett. 2006 Feb 15;16(4):897-900.
• [55] Distinct pharmacology of rat and human histamine H(3) receptors: role of two amino acids in the third transmembrane domain. Br J Pharmacol. 2000 Dec;131(7):1247-50.
• [56] Synthesis and structure-activity relationships of conformationally constrained histamine H(3) receptor agonists. J Med Chem. 2003 Dec 4;46(25):5445-57.
• [57] Synthesis and biological activity of piperazine and diazepane amides that are histamine H3 antagonists and serotonin reuptake inhibitors. Bioorg Med Chem Lett. 2008 Jan 1;18(1):39-43.
• [58] Ureas with histamine H3-antagonist receptor activity--a new scaffold discovered by lead-hopping from cinnamic acid amides. Bioorg Med Chem Lett. 2006 Oct 15;16(20):5303-8.
• [59] Molecular and pharmacological characterization of the mouse histamine H3 receptor. Eur J Pharmacol. 2003 Apr 25;467(1-3):57-65.
• [60] Constitutive activity of histamine h(3) receptors stably expressed in SK-N-MC cells: display of agonism and inverse agonism by H(3) antagonists. J Pharmacol Exp Ther. 2001 Dec;299(3):908-14.
• [61] Fragment based design of new H4 receptor-ligands with anti-inflammatory properties in vivo. J Med Chem. 2008 Apr 24;51(8):2457-67.
• [62] Characterization of the binding of the first selective radiolabelled histamine H3-receptor antagonist, [125I]-iodophenpropit, to rat brain. Br J Pharmacol. 1994 Oct;113(2):355-62.