Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTEB0GD)

DTT Name Cholinesterase (BCHE)
Synonyms Pseudocholinesterase; Choline esterase II; CHE1; Butyrylcholine esterase; Acylcholine acylhydrolase
Gene Name BCHE
DTT Type
Successful target
 [1]
BioChemical Class
Type-B carboxylesterase/lipase
UniProt ID
CHLE_HUMAN
TTD ID
T99799
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
EC 3.1.1.8
Sequence
MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFGGTVTAFLGIP
YAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDC
LYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALG
FLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPG
SHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEI
LLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVNKDEGTAFLVY
GAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDV
VGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLER
RDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMT
KLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCV
GL
Function Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters.
Reactome Pathway
Synthesis of PC (R-HSA-1483191 )
Synthesis, secretion, and deacylation of Ghrelin (R-HSA-422085 )
Aspirin ADME (R-HSA-9749641 )
Neurotransmitter clearance (R-HSA-112311 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
2 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Hexafluronium bromide DMFY307 Spasm MB47.3 Approved [1]
MEPTAZINOL DMPSB8F Pain MG30-MG3Z Approved [2]
------------------------------------------------------------------------------------
5 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(-)-Phenserine DMNCY1I Alzheimer disease 8A20 Phase 3 [3]
Eptastigmine DMTV7ZM Cognitive impairment 6D71 Phase 3 [4]
JES-9501 DMYR3IE Alzheimer disease 8A20 Phase 1 [5]
Plasma derived human butyrylcholinesterase DMF3IBC Neurotoxicity NE61 Phase 1 [6]
Protexia DME1Y9W Alzheimer disease 8A20 Phase 1 [7]
------------------------------------------------------------------------------------
22 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Decyle nelycorine dibromo salt derivative 1 DMXKUMJ N. A. N. A. Patented [8]
Di-substituted piperidine derivative 1 DM3OCXI N. A. N. A. Patented [8]
Di-substituted piperidine derivative 2 DM23XQL N. A. N. A. Patented [8]
Di-substituted piperidine derivative 3 DM2IBX9 N. A. N. A. Patented [8]
Egonol compound 1 DMQF1UM N. A. N. A. Patented [9]
Indoline derivative 1 DMJ41UI N. A. N. A. Patented [8]
Isochroman-4-ketone derivative 1 DMDBK6O N. A. N. A. Patented [8]
Oxime derivative 1 DMWUYIB N. A. N. A. Patented [8]
PMID29757691-Compound-10 DMZBHR9 N. A. N. A. Patented [8]
PMID29757691-Compound-2a DMEUC04 N. A. N. A. Patented [8]
PMID29757691-Compound-2a-i DMBRQP1 N. A. N. A. Patented [8]
PMID29757691-Compound-7 DM7TPBF N. A. N. A. Patented [8]
PMID29757691-Compound-8a DM5IFBV N. A. N. A. Patented [8]
PMID29757691-Compound-8b DMEOZKF N. A. N. A. Patented [8]
PMID29757691-Compound-8c DMHL7SW N. A. N. A. Patented [8]
PMID29757691-Compound-8d DM6PDEH N. A. N. A. Patented [8]
Quinazoline alkaloid derivative 1 DMH86F2 N. A. N. A. Patented [8]
Tacrine heterodimer derivative 1 DMFOKRW N. A. N. A. Patented [8]
Tetra-hydro-isoquinoline derivative 1 DML86IO N. A. N. A. Patented [8]
Tetra-hydro-isoquinoline derivative 2 DM5CKVF N. A. N. A. Patented [8]
Tetra-hydro-isoquinoline derivative 3 DMCZA45 N. A. N. A. Patented [8]
Tetra-hydro-isoquinoline derivative 4 DMDV0MP N. A. N. A. Patented [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 22 Patented Agent(s)
209 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(-)-DEBROMOFLUSTRAMINE B DM6LGHU Discovery agent N.A. Investigative [10]
(-)-Phenethylcymserine DMVUEW5 Discovery agent N.A. Investigative [3]
(-)-Tolserine DMAT58Z Discovery agent N.A. Investigative [3]
(1'H-Phenothiazin-1'-yl)(piperidin-1-yl)methanone DMHEYOK Discovery agent N.A. Investigative [11]
(10H-phenothiazin-10-yl)(m-tolyl)methanone DM2J9RI Discovery agent N.A. Investigative [12]
(10H-phenothiazin-10-yl)(o-tolyl)methanone DM8BKTV Discovery agent N.A. Investigative [12]
(10H-phenothiazin-10-yl)(p-tolyl)methanone DMRQ0ZF Discovery agent N.A. Investigative [12]
(10H-phenothiazin-10-yl)(phenyl)methanone DMT3GAD Discovery agent N.A. Investigative [12]
(1R)-MENTHYL HEXYL PHOSPHONATE GROUP DMGAJYW Discovery agent N.A. Investigative [13]
(1S)-MENTHYL HEXYL PHOSPHONATE GROUP DMJ2WD5 Discovery agent N.A. Investigative [13]
(24S)-ethylcholesta-7,9(11),22(E)-triene-3b-ol DMPL80G Discovery agent N.A. Investigative [14]
(3-bromophenyl)(10H-phenothiazin-10-yl)methanone DMIJH7W Discovery agent N.A. Investigative [12]
(4-bromophenyl)(10H-phenothiazin-10-yl)methanone DMLAEPF Discovery agent N.A. Investigative [12]
(4-nitrophenyl)(10H-phenothiazin-10-yl)methanone DM1YC0B Discovery agent N.A. Investigative [12]
(RS)-tacrine(10)-hupyridone DMCN6WR Discovery agent N.A. Investigative [15]
1,10-bis(pyridinium)-decane dibromide DM6VCI3 Discovery agent N.A. Investigative [16]
1,11-bis(pyridinium)-undecane dibromide DMVXYZL Discovery agent N.A. Investigative [16]
1,2-bis(2,3-fluorophenyl)ethane-1,2-dione DM9Z1NY Discovery agent N.A. Investigative [17]
1,2-di(10H-phenothiazin-10-yl)ethane-1,2-dione DMJAK0E Discovery agent N.A. Investigative [12]
1,2-Di(berberine-9-O-yl)ethane dibromide DM7S1D5 Discovery agent N.A. Investigative [18]
1,2-indanedione DMV275G Discovery agent N.A. Investigative [19]
1,2-NAPHTHOQUINONE DMYXELH Discovery agent N.A. Investigative [19]
1,3-Di(berberine-9-O-yl)ethane dibromide DMZKUOX Discovery agent N.A. Investigative [18]
1,4-Di(berberine-9-O-yl)ethane dibromide DM87MWN Discovery agent N.A. Investigative [18]
1,9-bis(pyridinium)-nonane dibromide DMWC7QE Discovery agent N.A. Investigative [16]
1-(10H-phenothiazin-10-yl)-2-phenylbutan-1-one DMKIWBT Discovery agent N.A. Investigative [12]
1-(10H-phenothiazin-10-yl)-2-phenylethanone DM5WBMY Discovery agent N.A. Investigative [12]
1-(10H-phenothiazin-10-yl)-2-phenylpropan-1-one DMYWG7D Discovery agent N.A. Investigative [12]
1-(10H-phenothiazin-10-yl)-3-phenylbutan-1-one DMZCPAQ Discovery agent N.A. Investigative [12]
1-(10H-phenothiazin-10-yl)-3-phenylpropan-1-one DMJQNLR Discovery agent N.A. Investigative [12]
1-(10H-phenothiazin-10-yl)-4-phenylbutan-1-one DMGY32O Discovery agent N.A. Investigative [12]
1-(3,4-dichlorobenzyl)-1H-indole-2,3-dione DMX71K9 Discovery agent N.A. Investigative [20]
1-methyl-3-(phenylcarbamoyloxy)pyridinium bromide DMC3IGK Discovery agent N.A. Investigative [3]
2,3-dihydropyrrolo[2,1-b]quinazolin-9(1H)-imine DMYHFUO Discovery agent N.A. Investigative [21]
2-(N-Morpholino)-Ethanesulfonic Acid DMZVHSB Discovery agent N.A. Investigative [22]
2-biphenyl-4-yl-1-phenothiazin-10-yl-ethanone DMHS3N6 Discovery agent N.A. Investigative [12]
2-methoxyphenyl 10H-phenothiazine-10-carboxylate DMQS8VE Discovery agent N.A. Investigative [23]
2-Methyl-beta-carboline-2-ium iodide DMQBF7J Discovery agent N.A. Investigative [24]
2-Propyl-beta-carboline-2-ium iodide DMBW6GA Discovery agent N.A. Investigative [24]
24-ethyl-cholest-7-ene-3,5,6-triol DMQSTYZ Discovery agent N.A. Investigative [14]
24-ethylcholest-6-ene-3,5-diol DMZIQ56 Discovery agent N.A. Investigative [14]
3,4,5,6-Tetrachloro-[1,2]benzoquinone DMSV6K5 Discovery agent N.A. Investigative [25]
3-(2-Diethylamino-acetamino)-rutaecarpine DM08GRF Discovery agent N.A. Investigative [26]
3-(2-Diethylamino-propionamino)-rutaecarpine DM1FOIZ Discovery agent N.A. Investigative [26]
3-(2-N-Piperidyl-propionamino)-rutaecarpine DMFEHDY Discovery agent N.A. Investigative [26]
3-(2-N-Pyrrolyl-acetamino)-rutaecarpine DMQ0A8W Discovery agent N.A. Investigative [26]
3-(2-N-Pyrrolyl-propionamino)-rutaecarpine DM9MRTW Discovery agent N.A. Investigative [26]
3-(dimethylamino)phenyl phenylcarbamate DMM05G2 Discovery agent N.A. Investigative [3]
3-chlorophenyl 10H-phenothiazine-10-carboxylate DMQCVKO Discovery agent N.A. Investigative [23]
3-isopr-sal-cyclosal-d4TMP DMZPGBT Discovery agent N.A. Investigative [27]
3-methoxyphenyl 10H-phenothiazine-10-carboxylate DMKHVGJ Discovery agent N.A. Investigative [23]
3-phenyl-cyclosal-d4TMP DM3LM6B Discovery agent N.A. Investigative [27]
3-sal-cyclosal-d4TMP DMCD4GR Discovery agent N.A. Investigative [27]
3-[10-(benzylmethylamino)decyloxy]xanthen-9-one DMBHUP3 Discovery agent N.A. Investigative [28]
3-[11-(benzylmethylamino)undecyloxy]xanthen-9-one DM287UO Discovery agent N.A. Investigative [28]
3-[12-(benzylmethylamino)dodecyloxy]xanthen-9-one DM9KVHQ Discovery agent N.A. Investigative [28]
3-[3-(benzylmethylamino)propoxy]xanthen-9-one DMPVXTB Discovery agent N.A. Investigative [28]
3-[4-(benzylmethylamino)butoxy]xanthen-9-one DMZPULH Discovery agent N.A. Investigative [28]
3-[5-(benzylmethylamino)pentyloxy]xanthen-9-one DMQZ0A7 Discovery agent N.A. Investigative [28]
3-[6-(benzylmethylamino)hexyloxy]xanthen-9-one DM89RN3 Discovery agent N.A. Investigative [28]
3-[7-(benzylmethylamino)-heptyloxy]xanthen-9-one DMMD3G6 Discovery agent N.A. Investigative [28]
3-[8-(benzylmethylamino)octyloxy]xanthen-9-one DM31WYF Discovery agent N.A. Investigative [28]
3-[9-(benzylmethylamino)nonyloxy]xanthen-9-one DMZSBU5 Discovery agent N.A. Investigative [28]
4-chlorophenyl 10H-phenothiazine-10-carboxylate DMPINBR Discovery agent N.A. Investigative [23]
4-ISOPROPYLPHENSERINE DMMDGR2 Discovery agent N.A. Investigative [29]
4-methoxyphenyl 10H-phenothiazine-10-carboxylate DM3L76R Discovery agent N.A. Investigative [23]
4-[4-(benzyloxy)piperidino]butyl benzoate DMTDYHE Discovery agent N.A. Investigative [30]
4-[4-(benzyloxy)piperidino]butyl-3-chlorobenzoate DMIXRCS Discovery agent N.A. Investigative [30]
4-[4-(benzyloxy)piperidino]butyl-3-fluorobenzoate DM87AYP Discovery agent N.A. Investigative [30]
4-[4-(benzyloxy)piperidino]butyl-4-chlorobenzoate DM0V8MA Discovery agent N.A. Investigative [30]
4-[4-(benzyloxy)piperidino]butyl-4-fluorobenzoate DML7UQ1 Discovery agent N.A. Investigative [30]
4-[4-(benzyloxy)piperidino]butyl-4-nitrobenzoate DMNOD2Q Discovery agent N.A. Investigative [30]
5,6-dinitroacenaphthoquinone DM07HYA Discovery agent N.A. Investigative [19]
5-methyl-cyclosal-d4TMP DMRC8SO Discovery agent N.A. Investigative [27]
6-chlorotacrine hydrochloride DMV0C69 Discovery agent N.A. Investigative [31]
6-hydroxy-1,2,9-trimethyl-9H-beta-carbolin-2-ium DMWLN2Y Discovery agent N.A. Investigative [32]
6-hydroxy-1,2-dimethyl-9H-beta-carbolin-2-ium DM20DAG Discovery agent N.A. Investigative [32]
6-hydroxy-2-methyl-9H-beta-carbolin-2-ium DMAK35M Discovery agent N.A. Investigative [32]
6-methoxy-1,2-dimethyl-9H-beta-carbolin-2-ium DMJUT70 Discovery agent N.A. Investigative [32]
6-methoxy-1,9-dimethyl-9H-pyrido[3,4-b]indole DMOHWPD Discovery agent N.A. Investigative [32]
6-methoxy-2-methyl-9H-beta-carbolin-2-ium DMHITF8 Discovery agent N.A. Investigative [32]
7-Oxo-7H-dibenzo[de,g]quinoline DMJZR0A Discovery agent N.A. Investigative [33]
9-(3-IODOBENZYLAMINO)-1,2,3,4-TETRAHYDROACRIDINE DMOP5AJ Discovery agent N.A. Investigative [13]
9-Ethyl-2-methyl-beta-carboline-2-ium iodide DM70MPJ Discovery agent N.A. Investigative [24]
9-N-Phenylmethylamino-Tacrine DMGMD1K Discovery agent N.A. Investigative [22]
9-O-[2-(Phenylol-1-yloxy)ethyl]berberine bromide DMYXEJ8 Discovery agent N.A. Investigative [34]
9-O-[2-(Phenylol-1-yloxy)hexyl]berberine bromide DM081G2 Discovery agent N.A. Investigative [34]
9-O-[3-(2-Pyridinoxyl)butyl]-berberine bromide DMHRV2A Discovery agent N.A. Investigative [18]
9-O-[3-(4-Bromo-phenoxyl)butyl]-berberine bromide DM4JG9S Discovery agent N.A. Investigative [18]
9-O-[3-(4-Nitro-phenoxyl)butyl]-berberine bromide DMWVSPH Discovery agent N.A. Investigative [18]
9-O-[3-(Phenylamino)propyl]-berberine bromide DMKPUWX Discovery agent N.A. Investigative [18]
9-O-[3-(Phenylol-1-yloxy)propyl]berberine bromide DM0FNUX Discovery agent N.A. Investigative [34]
9-O-[4-(Phenylol-1-yloxy)butyl]berberine bromide DM58XF6 Discovery agent N.A. Investigative [34]
9-O-[5-(Phenylol-1-yloxy)pentyl]berberine bromide DMPZTG9 Discovery agent N.A. Investigative [34]
9-[5-(beta-Carboline-9-yl)pentyl]-beta-carboline DMFR3SD Discovery agent N.A. Investigative [24]
9-[9-(beta-Carboline-9-yl)nonyl]-beta-carboline DM6M5A4 Discovery agent N.A. Investigative [24]
ACENAPHTHOQUINONE DMU3DMH Discovery agent N.A. Investigative [19]
Alpha-D-Mannose DMF5DLW Discovery agent N.A. Investigative [22]
Anthracen-10-yl(10H-phenothiazin-10-yl)methanone DMGEMQX Discovery agent N.A. Investigative [12]
AS-1397 DMPX5SJ Discovery agent N.A. Investigative [35]
BENZOQUINONE DMNBA0G Discovery agent N.A. Investigative [25]
Beta-D-Mannose DMHIG9K Discovery agent N.A. Investigative [22]
Bis-7-tacrine DMVNC1R Discovery agent N.A. Investigative [36]
Bis-cyclosal-d4TMP DMF4AHD Discovery agent N.A. Investigative [27]
Butanoic Acid DMTAJP7 Discovery agent N.A. Investigative [22]
Butyl 10H-phenothiazine-10-carboxylate DMGHEQV Discovery agent N.A. Investigative [23]
Butyrylthiocholine DMOBYVL Discovery agent N.A. Investigative [37]
CAPROCTAMINE DMDZE8N Discovery agent N.A. Investigative [38]
CHF-2819 DMLJGVX Discovery agent N.A. Investigative [39]
CHLORANIL DMCHGF1 Discovery agent N.A. Investigative [25]
Cyclopentyl 10H-phenothiazine-10-carboxylate DMMV2LN Discovery agent N.A. Investigative [23]
Cyclosal-d4TMP DMLC041 Discovery agent N.A. Investigative [27]
DEMETHYLDEBROMOFLUSTRAMINE B DMJBAEP Discovery agent N.A. Investigative [10]
Diethylphosphono Group DMM4QFL Discovery agent N.A. Investigative [22]
Dodecanesulfonate ion DMCNFEL Discovery agent N.A. Investigative [13]
Ethyl Dihydrogen Phosphate DMW0J3D Discovery agent N.A. Investigative [22]
ETHYL HYDROGEN DIETHYLAMIDOPHOSPHATE DMT4XJM Discovery agent N.A. Investigative [13]
Fucose DMAHMSV N. A. N. A. Investigative [22]
HALOXYSTEROL A DM4AEGQ Discovery agent N.A. Investigative [14]
HALOXYSTEROL B DMD8O7S Discovery agent N.A. Investigative [14]
Haloxysterol C DMU1DHM Discovery agent N.A. Investigative [14]
Haloxysterol D DMWCZLT Discovery agent N.A. Investigative [14]
Huprine X DMTPXB6 Discovery agent N.A. Investigative [40]
Huprine-Tacrine Heterodimer DMJ4ME7 Discovery agent N.A. Investigative [41]
Iso-OMPA DMFX16H Discovery agent N.A. Investigative [42]
Isopropyl 10H-phenothiazine-10-carboxylate DMH67J2 Discovery agent N.A. Investigative [23]
Isosorbide-2-(benzylcarbamate)-5-benzoate DMTRCSV Discovery agent N.A. Investigative [42]
Isosorbide-2-(benzylcarbamate)-5-mononitrate DMG0TW2 Discovery agent N.A. Investigative [42]
Isosorbide-2-(butylcarbamate)-5-benzoate DM1ZH2U Discovery agent N.A. Investigative [42]
Isosorbide-2-(butylcarbamate)-5-mononitrate DMUDS12 Discovery agent N.A. Investigative [42]
Isosorbide-2-(cyclohexylcarbamate)-5-mononitrate DM4ZYRP Discovery agent N.A. Investigative [42]
Isosorbide-2-(ethylcarbamate)-5-mononitrate DMMH70I Discovery agent N.A. Investigative [42]
Isosorbide-2-(methylcarbamate)-5-benzoate DMC7MLN Discovery agent N.A. Investigative [42]
Isosorbide-2-(methylcarbamate)-5-mononitrate DMEKMOF Discovery agent N.A. Investigative [42]
Isosorbide-2-(propylcarbamate)-5-mononitrate DMQAEZP Discovery agent N.A. Investigative [42]
Isosorbide-2-benzyl carbamate DM6FVDO Discovery agent N.A. Investigative [43]
Isosorbide-2-benzylcarbamate-5-(o-toluate) DM5XEZI Discovery agent N.A. Investigative [43]
Isosorbide-2-benzylcarbamate-5-acetate DMD4WRH Discovery agent N.A. Investigative [42]
Isosorbide-2-benzylcarbamate-5-cyclopentanoate DMWDQ90 Discovery agent N.A. Investigative [42]
Isosorbide-2-benzylcarbamate-5-cyclopropanoate DM8E2L6 Discovery agent N.A. Investigative [42]
Isosorbide-2-benzylcarbamate-5-isonicotinate DMQ3Z17 Discovery agent N.A. Investigative [42]
Isosorbide-2-benzylcarbamate-5-nicotinate DMY49DN Discovery agent N.A. Investigative [42]
Isosorbide-2-benzylcarbamate-5-pentanoate DMSQ538 Discovery agent N.A. Investigative [42]
Isosorbide-2-benzylcarbamate-5-propionate DMP6E34 Discovery agent N.A. Investigative [42]
Isosorbide-2-benzylcarbamate-5-triflate DMG69IX Discovery agent N.A. Investigative [42]
Isosorbide-di-(benzylcarbamate) DMFVN71 Discovery agent N.A. Investigative [44]
Isosorbide-di-(butylcarbamate) DMNSTKD Discovery agent N.A. Investigative [44]
Isosorbide-di-(ethylcarbamate) DMTHWXO Discovery agent N.A. Investigative [44]
Isosorbide-di-(propylcarbamate) DMV1GLP Discovery agent N.A. Investigative [44]
LAWSARITOL DM5GNFO Discovery agent N.A. Investigative [14]
LIPOCRINE DMUIVCX Discovery agent N.A. Investigative [45]
M-tolyl 10H-phenothiazine-10-carboxylate DMXPIKT Discovery agent N.A. Investigative [23]
MEMOQUIN DM9S30P Discovery agent N.A. Investigative [45]
Methyl 10H-phenothiazine-10-carboxylate DMGYZHU Discovery agent N.A. Investigative [23]
Methyl Phosphinic Acid DM096SI Discovery agent N.A. Investigative [22]
MF-8623 DM1FEVB Discovery agent N.A. Investigative [29]
Monoisopropyl Ester Phosphonic Acid Group DMNJXHF Discovery agent N.A. Investigative [22]
Morpholino(1'H-phenothiazin-1'-yl)methanone DM05L3S Discovery agent N.A. Investigative [11]
N,N'-(1',10'-decylene)-bis-(-)-nor-MEP DMIX0CT Discovery agent N.A. Investigative [2]
N,N'-(1',11'-undecydene)-bis-(-)-nor-MEP DM5NVIO Discovery agent N.A. Investigative [2]
N,N'-(1',12'-dodecydene)-bis-(-)-nor-MEP DMWI06H Discovery agent N.A. Investigative [2]
N,N'-(1',2'-ethylene)-bis-(-)-nor-MEP DM1LKEP Discovery agent N.A. Investigative [2]
N,N'-(1',3'-propylene)-bis-(-)-nor-MEP DM4G6BT Discovery agent N.A. Investigative [2]
N,N'-(1',4'-butylene)-bis-(-)-nor-MEP DMZHBTA Discovery agent N.A. Investigative [2]
N,N'-(1',5'-pentylene)-bis-(-)-nor-MEP DMBPC0K Discovery agent N.A. Investigative [2]
N,N'-(1',6-hexylene)-bis-(-)-nor-MEP DMU4BIW Discovery agent N.A. Investigative [2]
N,N'-(1',7'-heptylene)-bis-(-)-nor-MEP DMSORHA Discovery agent N.A. Investigative [2]
N,N'-(1',8'-octylene)-bis-(-)-nor-MEP DMHFYK2 Discovery agent N.A. Investigative [2]
N,N'-(1',9'-nonylene)-bis-(-)-nor-MEP DMIWF7U Discovery agent N.A. Investigative [2]
N,N-Diethyl-1'H-phenothiazine-1'-carboxamide DM5K3D2 Discovery agent N.A. Investigative [11]
N,N-Diisopropyl-1'H-phenothiazine-1'-carboxamide DM4E8C9 Discovery agent N.A. Investigative [11]
N,N-Dimethyl-1'H-phenothiazine-1'-carboxamide DM4CDYG Discovery agent N.A. Investigative [11]
N,N-Dipropyl-1'H-phenothiazine-1'-carboxamide DM8769D Discovery agent N.A. Investigative [11]
N-(Adamant-1-yl)-1'H-phenothiazine-1'-carboxamide DMFONC1 Discovery agent N.A. Investigative [11]
N-Benzyl-1'H-phenothiazine-1'-carboxamide DMC7XST Discovery agent N.A. Investigative [11]
N-benzyl-2-thiomorpholinopyrimidin-4-amine DMRJMGK Discovery agent N.A. Investigative [36]
N-Cyclobutyl-1'H-phenothiazine-1'-carboxamide DM5T23S Discovery agent N.A. Investigative [11]
N-Cyclohexyl-1'H-phenothiazine-1'-carboxamide DMMW8J1 Discovery agent N.A. Investigative [11]
N-Cyclopentyl-1'H-phenothiazine-1'-carboxamide DM0KDSA Discovery agent N.A. Investigative [11]
N-Isopropyl-1'H-phenothiazine-1'-carboxamide DM14L7O Discovery agent N.A. Investigative [11]
N-Methyl-1'H-phenothiazine-1'-carboxamide DMK8VZM Discovery agent N.A. Investigative [11]
N-n-heptyl-7-methoxytacrine hydrochloride DMA8R47 Discovery agent N.A. Investigative [46]
N-n-hexyl-7-methoxytacrine hydrochloride DM4ZMG6 Discovery agent N.A. Investigative [46]
N-n-nonyl-7-methoxytacrine hydrochloride DMLH23M Discovery agent N.A. Investigative [46]
N-n-octyl-7-methoxytacrine hydrochloride DMLC257 Discovery agent N.A. Investigative [46]
N-n-pentyl-7-methoxytacrine hydrochloride DMWAK5V Discovery agent N.A. Investigative [46]
N-Neopentyl-1'H-phenothiazine-1'-carboxamide DMSUK2A Discovery agent N.A. Investigative [11]
N-o-Tolyl-1'H-phenothiazine-1'-carboxamide DMLVFUY Discovery agent N.A. Investigative [11]
N-p-Tolyl-1'H-phenothiazine-1'-carboxamide DMMR7DI Discovery agent N.A. Investigative [11]
N-phenethyl-2-(pyrrolidin-1-yl)pyrimidin-4-amine DMJQZMH Discovery agent N.A. Investigative [36]
N-Phenyl-1'H-phenothiazine-1'-carboxamide DM1LHD3 Discovery agent N.A. Investigative [11]
N-tert-Butyl-1'H-phenothiazine-1'-carboxamide DMOPSJU Discovery agent N.A. Investigative [11]
Naphthalen-1-yl 10H-phenothiazine-10-carboxylate DMYDRB7 Discovery agent N.A. Investigative [23]
Naphthalen-1-yl(10H-phenothiazin-10-yl)methanone DM93CZW Discovery agent N.A. Investigative [12]
Naphthalen-2-yl 10H-phenothiazine-10-carboxylate DM08W6U Discovery agent N.A. Investigative [23]
Naphthalen-2-yl(10H-phenothiazin-10-yl)methanone DMW8BXG Discovery agent N.A. Investigative [12]
Non-PEGylated butyrylcholinesterase DMMJFTR Toxicity N.A. Investigative [47]
NOSTOCARBOLINE DME5O17 Discovery agent N.A. Investigative [48]
NP-0336 DM906YB Cognitive impairment 6D71 Investigative [47]
NSC-23180 DMJ91Y7 Discovery agent N.A. Investigative [19]
O-tolyl 10H-phenothiazine-10-carboxylate DM0R6MT Discovery agent N.A. Investigative [23]
P-tolyl 10H-phenothiazine-10-carboxylate DMDGUEK Discovery agent N.A. Investigative [23]
Phenanthrene-9,10-dione DMG8KS9 Discovery agent N.A. Investigative [19]
Phenyl 10H-phenothiazine-10-carboxylate DM52H1D Discovery agent N.A. Investigative [23]
Recombinant human butyrylcholinesterase DMM3465 Poison intoxication NE6Z Investigative [47]
Tert-butyl 10H-phenothiazine-10-carboxylate DMW2X5V Discovery agent N.A. Investigative [23]
TOLSERINE DMPTM6V Discovery agent N.A. Investigative [4]
VAGANINE D DMEOJ89 Discovery agent N.A. Investigative [49]
XANTHOSTIGMINE DM38TLN Discovery agent N.A. Investigative [50]
------------------------------------------------------------------------------------
⏷ Show the Full List of 209 Investigative Drug(s)

References

1 Synergistic effect of acidosis and succinylcholine-induced hyperkalemia in spinal cord transected rats. Acta Anaesthesiol Scand. 1984 Feb;28(1):87-90.
2 Bis-(-)-nor-meptazinols as novel nanomolar cholinesterase inhibitors with high inhibitory potency on amyloid-beta aggregation. J Med Chem. 2008 Apr 10;51(7):2027-36.
3 Long-acting anticholinesterases for myasthenia gravis: synthesis and activities of quaternary phenylcarbamates of neostigmine, pyridostigmine and physostigmine. Bioorg Med Chem. 2010 Jul 1;18(13):4687-93.
4 Inhibition of human acetyl- and butyrylcholinesterase by novel carbamates of (-)- and (+)-tetrahydrofurobenzofuran and methanobenzodioxepine. J Med Chem. 2006 Apr 6;49(7):2174-85.
5 Dehydroevodiamine attenuates beta-amyloid peptide-induced amnesia in mice. Eur J Pharmacol. 2001 Feb 16;413(2-3):221-5.
6 Acetylcholinesterase-Fc Fusion Protein (AChE-Fc): A Novel Potential Organophosphate Bioscavenger with Extended Plasma Half-Life. Bioconjug Chem. 2015 Aug 19;26(8):1753-8.
7 In vitro and in vivo characterization of recombinant human butyrylcholinesterase (Protexia) as a potential nerve agent bioscavenger. Chem Biol Interact. 2005 Dec 15;157-158:363-5.
8 A patent review of butyrylcholinesterase inhibitors and reactivators 2010-2017.Expert Opin Ther Pat. 2018 Jun;28(6):455-465.
9 Recent advances in acetylcholinesterase Inhibitors and Reactivators: an update on the patent literature (2012-2015).Expert Opin Ther Pat. 2017 Apr;27(4):455-476.
10 Synthesis and biological evaluation of (-)- and (+)-debromoflustramine B and its analogues as selective butyrylcholinesterase inhibitors. J Med Chem. 2008 Sep 11;51(17):5271-84.
11 Differential binding of phenothiazine urea derivatives to wild-type human cholinesterases and butyrylcholinesterase mutants. Bioorg Med Chem. 2010 Mar 15;18(6):2232-2244.
12 Selective reversible inhibition of human butyrylcholinesterase by aryl amide derivatives of phenothiazine. Bioorg Med Chem. 2007 Oct 1;15(19):6367-78.
13 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
14 Isolation and cholinesterase-inhibition studies of sterols from Haloxylon recurvum. Bioorg Med Chem Lett. 2006 Feb;16(3):573-80.
15 Exploiting protein fluctuations at the active-site gorge of human cholinesterases: further optimization of the design strategy to develop extremely... J Med Chem. 2008 Jun 12;51(11):3154-70.
16 Preparation and in vitro screening of symmetrical bispyridinium cholinesterase inhibitors bearing different connecting linkage-initial study for My... Bioorg Med Chem Lett. 2010 Mar 1;20(5):1763-6.
17 Analysis of the inhibition of mammalian carboxylesterases by novel fluorobenzoins and fluorobenzils. Bioorg Med Chem. 2007 Jun 1;15(11):3801-17.
18 Synthesis and biological evaluation of a new series of berberine derivatives as dual inhibitors of acetylcholinesterase and butyrylcholinesterase. Bioorg Med Chem. 2010 Jun 15;18(12):4475-84.
19 Planarity and constraint of the carbonyl groups in 1,2-diones are determinants for selective inhibition of human carboxylesterase 1. J Med Chem. 2007 Nov 15;50(23):5727-34.
20 Selective inhibition of carboxylesterases by isatins, indole-2,3-diones. J Med Chem. 2007 Apr 19;50(8):1876-85.
21 Homobivalent quinazolinimines as novel nanomolar inhibitors of cholinesterases with dirigible selectivity toward butyrylcholinesterase. J Med Chem. 2006 Sep 7;49(18):5411-3.
22 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
23 Carbamates with differential mechanism of inhibition toward acetylcholinesterase and butyrylcholinesterase. J Med Chem. 2008 Jul 24;51(14):4200-12.
24 Bivalent beta-carbolines as potential multitarget anti-Alzheimer agents. J Med Chem. 2010 May 13;53(9):3611-7.
25 Identification and characterization of novel benzil (diphenylethane-1,2-dione) analogues as inhibitors of mammalian carboxylesterases. J Med Chem. 2005 Apr 21;48(8):2906-15.
26 Synthesis and evaluation of novel rutaecarpine derivatives and related alkaloids derivatives as selective acetylcholinesterase inhibitors. Eur J Med Chem. 2010 Apr;45(4):1415-23.
27 Bis-cycloSal-d4T-monophosphates: drugs that deliver two molecules of bioactive nucleotides. J Med Chem. 2007 Mar 22;50(6):1335-46.
28 Cholinesterase inhibitors: SAR and enzyme inhibitory activity of 3-[omega-(benzylmethylamino)alkoxy]xanthen-9-ones. Bioorg Med Chem. 2007 Jan 1;15(1):575-85.
29 A new therapeutic target in Alzheimer's disease treatment: attention to butyrylcholinesterase. Curr Med Res Opin. 2001;17(3):159-65.
30 Synthesis, in vitro assay, and molecular modeling of new piperidine derivatives having dual inhibitory potency against acetylcholinesterase and Abe... Bioorg Med Chem. 2007 Oct 15;15(20):6596-607.
31 Pyrano[3,2-c]quinoline-6-chlorotacrine hybrids as a novel family of acetylcholinesterase- and beta-amyloid-directed anti-Alzheimer compounds. J Med Chem. 2009 Sep 10;52(17):5365-79.
32 6-Hydroxy- and 6-methoxy-beta-carbolines as acetyl- and butyrylcholinesterase inhibitors. Bioorg Med Chem Lett. 2006 Nov 15;16(22):5840-3.
33 Synthesis, biological evaluation and molecular modeling of oxoisoaporphine and oxoaporphine derivatives as new dual inhibitors of acetylcholinester... Eur J Med Chem. 2009 Jun;44(6):2523-32.
34 Synthesis, biological evaluation, and molecular modeling of berberine derivatives as potent acetylcholinesterase inhibitors. Bioorg Med Chem. 2010 Feb;18(3):1244-51.
35 Novel heterobivalent tacrine derivatives as cholinesterase inhibitors with notable selectivity toward butyrylcholinesterase. J Med Chem. 2006 Dec 14;49(25):7540-4.
36 Design, synthesis and evaluation of 2,4-disubstituted pyrimidines as cholinesterase inhibitors. Bioorg Med Chem Lett. 2010 Jun 15;20(12):3606-9.
37 DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.
38 Structure-activity relationships of acetylcholinesterase noncovalent inhibitors based on a polyamine backbone. 4. Further investigation on the inne... J Med Chem. 2008 Nov 27;51(22):7308-12.
39 Novel anticholinesterases based on the molecular skeletons of furobenzofuran and methanobenzodioxepine. J Med Chem. 2005 Feb 24;48(4):986-94.
40 Discovery of huperzine A-tacrine hybrids as potent inhibitors of human cholinesterases targeting their midgorge recognition sites. J Med Chem. 2006 Jun 1;49(11):3421-5.
41 Synthesis and pharmacological evaluation of huprine-tacrine heterodimers: subnanomolar dual binding site acetylcholinesterase inhibitors. J Med Chem. 2005 Mar 24;48(6):1701-4.
42 Isosorbide-2-carbamate esters: potent and selective butyrylcholinesterase inhibitors. J Med Chem. 2008 Oct 23;51(20):6400-9.
43 Isosorbide-2-benzyl carbamate-5-salicylate, a peripheral anionic site binding subnanomolar selective butyrylcholinesterase inhibitor. J Med Chem. 2010 Feb 11;53(3):1190-9.
44 Isosorbide-based cholinesterase inhibitors; replacement of 5-ester groups leading to increased stability. Bioorg Med Chem. 2010 Feb;18(3):1045-53.
45 Toward a rational design of multitarget-directed antioxidants: merging memoquin and lipoic acid molecular frameworks. J Med Chem. 2009 Dec 10;52(23):7883-6.
46 Synthesis and in vitro evaluation of N-alkyl-7-methoxytacrine hydrochlorides as potential cholinesterase inhibitors in Alzheimer disease. Bioorg Med Chem Lett. 2010 Oct 15;20(20):6093-5.
47 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2471).
48 Nostocarboline: isolation and synthesis of a new cholinesterase inhibitor from Nostoc 78-12A. J Nat Prod. 2005 Dec;68(12):1793-5.
49 Steroidal alkaloids from the leaves of Sarcococca coriacea of Nepalese origin. J Nat Prod. 2001 Jun;64(6):842-4.
50 Acetylcholinesterase inhibitors: synthesis and structure-activity relationships of omega-[N-methyl-N-(3-alkylcarbamoyloxyphenyl)- methyl]aminoalkox... J Med Chem. 1998 Oct 8;41(21):3976-86.