Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEQX145)

DME Name	Aromatase (CYP19A1)
Synonyms	Cytochrome P-450AROM; Cytochrome P450 19A1; Estrogen synthase; ARO1; CYAR; CYP19; CYP19A1; CYPXIX
Gene Name	CYP19A1
UniProt ID	CP19A_HUMAN
INTEDE ID	DME0002
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Gene ID	1588
EC Number	EC: 1.14.14.14 Oxidoreductase Oxygen paired donor oxidoreductase Flavin/flavoprotein donor oxidoreductase EC: 1.14.14.14
Lineage	Species: Homo sapiens Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Sequence	MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH PDETKNMLEMIFTPRNSDRCLEH
Function	This enzyme catalyzes the conversion of C19 androgens, androst-4-ene-3,17-dione (androstenedione) and testosterone to the C18 estrogens, estrone and estradiol, respectively. It catalyzes three successive oxidations of C19 androgens: two conventional oxidations at C19 yielding 19-hydroxy and 19-oxo/19-aldehyde derivatives, followed by a third oxidative aromatization step that involves C1-beta hydrogen abstraction combined with cleavage of the C10-C19 bond to yield a phenolic A ring and formic acid. Alternatively, the third oxidative reaction yields a 19-norsteroid and formic acid. Additionally, it converts dihydrotestosterone to delta1,10-dehydro 19- nordihydrotestosterone and also displays 2-hydroxylase activity toward estrone.
KEGG Pathway	Metabolic pathways (hsa01100 ) Ovarian steroidogenesis (hsa04913 ) Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway	Endogenous sterols (R-HSA-211976 ) Estrogen biosynthesis (R-HSA-193144 ) Defective CYP19A1 causes Aromatase excess syndrome (AEXS) (R-HSA-5579030 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DME

7 Approved Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Letrozole	DMH07Y3	Estrogen-receptor positive breast cancer		Approved	[52]
Levomethadyl acetate hydrochloride	DM429AE	N. A.	N. A.	Approved	[53]
Methadone	DMTW6IU	Advanced cancer	2A00-2F9Z	Approved	[54]
Nandrolone	DMFWKG1	Osteoporosis	FB83.0	Approved	[55]
Prasterone	DM67VKL	Chronic obstructive pulmonary disease	CA22	Approved	[56]
Testosterone cypionate	DMC1TEV	N. A.	N. A.	Approved	[57]
Dihydrotestosterone	DM3S8XC	Prostate hyperplasia	GA90	Phase 4	[58]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Approved Drug(s)

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	5.28E-01	3.01E-02	1.98E-01
Alopecia	ED70	Skin from scalp	7.59E-01	7.47E-03	3.33E-02
Alzheimer's disease	8A20	Entorhinal cortex	1.64E-01	-3.30E-02	-2.10E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	9.73E-01	-1.26E-01	-1.17E+00
Aortic stenosis	BB70	Calcified aortic valve	5.80E-01	1.52E-01	4.07E-01
Apnea	7A40	Hyperplastic tonsil	2.93E-01	-2.25E-01	-1.06E+00
Arthropathy	FA00-FA5Z	Peripheral blood	1.09E-01	-4.42E-02	-4.05E-01
Asthma	CA23	Nasal and bronchial airway	7.04E-02	3.25E-02	1.78E-01
Atopic dermatitis	EA80	Skin	4.90E-04	1.17E-01	1.20E+00
Autism	6A02	Whole blood	4.32E-02	-5.56E-02	-2.96E-01
Autoimmune uveitis	9A96	Peripheral monocyte	9.33E-02	-9.88E-02	-1.74E+00
Autosomal dominant monocytopenia	4B04	Whole blood	6.88E-02	1.86E-01	2.35E+00
Bacterial infection of gingival	1C1H	Gingival tissue	1.28E-01	7.80E-02	4.39E-01
Batten disease	5C56.1	Whole blood	3.66E-01	2.58E-02	3.11E-01
Behcet's disease	4A62	Peripheral blood	7.83E-01	-3.13E-02	-2.22E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	7.78E-01	-3.59E-02	-3.05E-01
Bladder cancer	2C94	Bladder tissue	1.60E-02	3.24E-01	1.05E+00
Breast cancer	2C60-2C6Z	Breast tissue	5.83E-02	-2.39E-02	-1.09E-01
Cardioembolic stroke	8B11.20	Whole blood	4.38E-01	1.27E-02	5.87E-02
Cervical cancer	2C77	Cervical tissue	7.29E-01	4.31E-02	1.12E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	3.01E-01	4.89E-02	3.88E-01
Chronic hepatitis C	1E51.1	Whole blood	6.73E-01	-8.70E-03	-6.79E-02
Chronic obstructive pulmonary disease	CA22	Lung tissue	3.49E-01	4.29E-02	4.65E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	3.88E-02	6.17E-02	5.26E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	5.34E-01	6.39E-02	6.84E-01
Colon cancer	2B90	Colon tissue	8.32E-01	1.59E-02	7.12E-02
Coronary artery disease	BA80-BA8Z	Peripheral blood	2.95E-01	-1.84E-01	-1.01E+00
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	4.04E-01	3.71E-02	4.48E-01
Endometriosis	GA10	Endometrium tissue	1.26E-01	-9.54E-03	-7.76E-02
Familial hypercholesterolemia	5C80.00	Peripheral blood	5.09E-01	2.41E-02	1.99E-01
Familial hypercholesterolemia	5C80.00	Whole blood	5.73E-01	5.36E-02	2.76E-01
Gastric cancer	2B72	Gastric tissue	2.26E-01	8.78E-02	7.95E-01
Glioblastopma	2A00.00	Nervous tissue	4.03E-08	-8.93E-02	-4.28E-01
Glioma	2A00.0Y-2A00.0Z	Brain stem tissue	3.81E-01	-9.68E-02	-1.26E+00
Glioma	2A00.0Y-2A00.0Z	White matter tissue	9.20E-01	-2.32E-01	-7.47E-01
Head and neck cancer	2D42	Head and neck tissue	1.38E-15	1.42E-01	1.13E+00
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	1.75E-02	-1.95E-01	-9.85E-01
Huntington's disease	8A01.10	Whole blood	4.60E-01	-4.92E-02	-3.26E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	4.56E-01	-7.03E-02	-2.63E-01
Immunodeficiency	4A00-4A20	Peripheral blood	2.69E-02	7.98E-02	6.22E-01
Influenza	1E30	Whole blood	1.68E-01	1.85E-01	1.71E+00
Interstitial cystitis	GC00.3	Bladder tissue	6.22E-01	4.83E-02	2.40E-01
Intracranial aneurysm	8B01.0	Intracranial artery	1.67E-02	-1.49E-01	-7.15E-01
Irritable bowel syndrome	DD91.0	Rectal colon tissue	1.33E-01	1.17E-01	3.99E-01
Ischemic stroke	8B11	Peripheral blood	8.17E-01	-1.92E-02	-1.68E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	2.55E-05	1.22E-01	7.37E-01
Lateral sclerosis	8B60.4	Skin	7.95E-01	3.84E-02	3.89E-01
Lateral sclerosis	8B60.4	Cervical spinal cord	5.27E-01	3.00E-02	2.29E-01
Liver cancer	2C12.0	Liver tissue	8.77E-01	-1.28E-02	-7.21E-02
Liver failure	DB99.7-DB99.8	Liver tissue	6.45E-01	2.61E-02	2.30E-01
Lung cancer	2C25	Lung tissue	1.81E-07	8.48E-02	5.24E-01
Lupus erythematosus	4A40	Whole blood	5.63E-06	1.26E-01	5.46E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	2.12E-01	3.01E-02	2.47E-01
Major depressive disorder	6A70-6A7Z	Whole blood	1.14E-01	5.68E-02	2.49E-01
Melanoma	2C30	Skin	2.07E-01	-1.37E-01	-4.16E-01
Multiple myeloma	2A83.1	Peripheral blood	8.01E-01	-6.10E-03	-8.61E-02
Multiple myeloma	2A83.1	Bone marrow	1.14E-03	-4.08E-01	-2.35E+00
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	3.16E-01	-5.50E-02	-1.79E-01
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	1.55E-02	5.45E-02	4.84E-01
Myelofibrosis	2A20.2	Whole blood	9.16E-02	1.52E-01	1.02E+00
Myocardial infarction	BA41-BA50	Peripheral blood	3.86E-03	1.40E-01	5.07E-01
Myopathy	8C70.6	Muscle tissue	9.98E-01	-8.95E-02	-5.90E-01
Neonatal sepsis	KA60	Whole blood	2.18E-06	1.15E-01	6.20E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	1.76E-03	-3.58E-01	-1.59E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	3.09E-02	-9.78E-02	-8.60E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	1.09E-01	5.19E-02	4.81E-01
Olive pollen allergy	CA08.00	Peripheral blood	5.98E-02	1.86E-01	9.21E-01
Oral cancer	2B6E	Oral tissue	9.74E-01	-1.51E-02	-5.05E-02
Osteoarthritis	FA00-FA0Z	Synovial tissue	3.01E-01	-3.95E-01	-1.16E+00
Osteoporosis	FB83.1	Bone marrow	5.09E-01	1.88E-02	1.39E-01
Ovarian cancer	2C73	Ovarian tissue	6.15E-02	-3.42E-01	-4.11E-01
Pancreatic cancer	2C10	Pancreas	6.96E-02	-6.62E-02	-1.90E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	8.69E-01	-1.95E-02	-1.02E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	4.47E-01	-6.54E-03	-4.55E-02
Pituitary cancer	2D12	Pituitary tissue	1.63E-01	1.58E-02	1.28E-01
Pituitary gonadotrope tumour	2D12	Pituitary tissue	6.26E-01	-1.04E-02	-8.79E-02
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	1.91E-01	-1.20E-01	-3.42E-01
Polycythemia vera	2A20.4	Whole blood	6.57E-03	8.68E-02	6.25E-01
Pompe disease	5C51.3	Biceps muscle	7.43E-02	-9.92E-02	-1.18E+00
Preterm birth	KA21.4Z	Myometrium	3.82E-01	5.30E-02	3.95E-01
Prostate cancer	2C82	Prostate	4.12E-01	2.66E-02	9.79E-02
Psoriasis	EA90	Skin	9.89E-01	5.04E-02	1.51E-01
Rectal cancer	2B92	Rectal colon tissue	7.28E-01	-1.25E-01	-6.48E-01
Renal cancer	2C90-2C91	Kidney	1.28E-03	-2.41E-01	-1.81E+00
Retinoblastoma	2D02.2	Uvea	9.72E-01	-1.20E-01	-6.41E-01
Rheumatoid arthritis	FA20	Synovial tissue	1.49E-02	-6.86E-01	-1.28E+00
Rhinovirus infection	CA42.1	Nasal epithelium tissue	8.01E-01	2.40E-02	1.76E-01
Schizophrenia	6A20	Prefrontal cortex	6.75E-01	-1.52E-03	-1.06E-02
Schizophrenia	6A20	Superior temporal cortex	2.98E-01	-3.41E-02	-2.10E-01
Scleroderma	4A42.Z	Whole blood	4.46E-03	1.26E-01	1.31E+00
Seizure	8A60-8A6Z	Whole blood	9.56E-01	3.53E-02	2.09E-01
Sensitive skin	EK0Z	Skin	4.96E-01	7.30E-02	1.09E+00
Sepsis with septic shock	1G41	Whole blood	3.55E-58	3.47E-01	1.52E+00
Shwachman-Diamond syndrome	3A70.0	Bone marrow	6.80E-01	6.63E-02	3.47E-01
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	3.65E-01	-1.90E-02	-7.52E-02
Simpson golabi behmel syndrome	LD2C	Adipose tissue	8.81E-01	-2.00E-02	-4.01E-01
Sjogren's syndrome	4A43.2	Salivary gland tissue	9.78E-01	1.24E-02	6.69E-02
Skin cancer	2C30-2C3Z	Skin	6.02E-02	-2.27E-04	-7.38E-04
Thrombocythemia	3B63	Whole blood	1.50E-01	1.84E-02	1.30E-01
Thrombocytopenia	3B64	Whole blood	8.90E-01	1.94E-02	1.57E-01
Thyroid cancer	2D10	Thyroid	3.98E-01	-2.83E-02	-1.67E-01
Tibial muscular dystrophy	8C75	Muscle tissue	1.92E-04	-1.80E-01	-1.31E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	1.58E-01	1.20E-01	1.54E+00
Type 2 diabetes	5A11	Liver tissue	4.59E-01	4.41E-02	4.31E-01
Ureter cancer	2C92	Urothelium	7.43E-01	-1.35E-01	-3.79E-01
Uterine cancer	2C78	Endometrium tissue	3.49E-05	9.70E-02	4.03E-01
Vitiligo	ED63.0	Skin	2.50E-02	-2.61E-01	-1.35E+00
------------------------------------------------------------------------------------


⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name

Aromatase (CYP19A1) DTT Info

DME DTT Type

Successful

6 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aminoglutethimide	DMWFHMZ	Cushing disease	5A70	Approved	[1]
Anastrozole	DMNP60F	Breast cancer	2C60-2C65	Approved	[2]
Exemestane	DM9HPW3	Hormonally-responsive breast cancer	2C60-2C65	Approved	[3]
FADROZOLE	DM3C5GZ	Breast cancer	2C60-2C65	Approved	[4]
Letrozole	DMH07Y3	Estrogen-receptor positive breast cancer		Approved	[3]
Testolactone	DMVY4GN	Breast cancer	2C60-2C65	Approved	[5]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Approved Drug(s)

4 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
LIAROZOLE	DM4OYXE	Dermatological disease	DA24.Y	Phase 2/3	[6]
BGS-649	DMO4MNQ	Endometriosis	GA10	Phase 2	[7]
Coumate	DMVKW0N	Breast cancer	2C60-2C65	Phase 2	[8]
NARINGENIN	DMHAZLM	N. A.	N. A.	Phase 1	[6]
------------------------------------------------------------------------------------

7 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
FORMESTANE	DMWIDJK	Breast cancer	2C60-2C65	Withdrawn from market	[9]
FINROZOLE	DM06SC9	Prostate disease	GA91	Discontinued in Phase 2	[10]
NKS-01	DMV5FN1	Bladder cancer	2C94	Discontinued in Phase 2	[11]
VOROZOLE	DM32N5G	N. A.	N. A.	Discontinued in Phase 2	[12]
YM-511	DM7WDAG	Breast cancer	2C60-2C65	Discontinued in Phase 2	[13]
MINAMESTANE	DM7IXH3	Bladder cancer	2C94	Terminated	[14]
Rogletimide	DM6JO30	Breast cancer	2C60-2C65	Terminated	[15]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Discontinued Drug(s)

220 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(+/-)-7-methoxy-2-(4-methoxyphenyl)chroman-4-one	DMYJGDK	Discovery agent	N.A.	Investigative	[16]
(+/-)-7-methoxy-2-phenylchroman-4-one	DMC0OKA	Discovery agent	N.A.	Investigative	[17]
(2S)-5,7,2',4'-tetrahydroxyflavanone	DMYVBHT	Discovery agent	N.A.	Investigative	[18]
(2S)-abyssinone II	DM5V3M1	Discovery agent	N.A.	Investigative	[18]
(2S)-euchrenone a7	DM6L0KZ	Discovery agent	N.A.	Investigative	[18]
1-(1-Benzyl-2-biphenyl-4-yl-ethyl)-1H-imidazole	DMLBCE5	Discovery agent	N.A.	Investigative	[19]
1-(2-(benzo[b]thiophen-4-yl)ethyl)-1H-imidazole	DMB3HI4	Discovery agent	N.A.	Investigative	[20]
1-(2-phenoxybenzyl)-1H-imidazole	DMLY4ER	Discovery agent	N.A.	Investigative	[21]
1-(3-(4-fluorophenyl)propyl)-1H-imidazole	DMWKXZ2	Discovery agent	N.A.	Investigative	[6]
1-(3-Methoxy-naphthalen-2-yl)-1H-imidazole	DM16U5F	Discovery agent	N.A.	Investigative	[22]
1-(4-Aminophenyl)-2-(1H-imidazol-1-yl)ethanone	DMMYT4W	Discovery agent	N.A.	Investigative	[23]
1-(4-Cyanobenzyl)-5-methyl-1H-imidazole	DMKC52N	Discovery agent	N.A.	Investigative	[24]
1-(4-nitro-2-phenoxybenzyl)-1H-imidazole	DMSRBUE	Discovery agent	N.A.	Investigative	[21]
1-(4-Nitro-2-phenylsulfanylbenzyl)-1H-imidazole	DMCP089	Discovery agent	N.A.	Investigative	[21]
1-(7-Methoxy-2-phenyl-chroman-4-yl)-1H-imidazole	DMLHDE3	Discovery agent	N.A.	Investigative	[25]
1-(9-phenyl-9H-fluoren-9-yl)-1H-1,2,4-triazole	DMVJZ0C	Discovery agent	N.A.	Investigative	[20]
1-(9-Phenyl-9H-fluoren-9-yl)1H-imidazole	DMLIJYS	Discovery agent	N.A.	Investigative	[6]
1-(9H-fluoren-9-yl)-1H-imidazole	DMH49OD	Discovery agent	N.A.	Investigative	[20]
1-(biphenyl-3-ylmethyl)-1H-1,2,4-triazole	DMGVPMT	Discovery agent	N.A.	Investigative	[8]
1-Bromo-4-imidazol-1-ylmethyl-xanthen-9-one	DMGL4MJ	Discovery agent	N.A.	Investigative	[26]
1-Ethyl-5-(imidazol-1-yl-phenyl-methyl)-1H-indole	DMUOSJG	Discovery agent	N.A.	Investigative	[27]
1-Imidazol-1-ylmethyl-4-nitro-xanthen-9-one	DMN7KHS	Discovery agent	N.A.	Investigative	[26]
1-Imidazol-1-ylmethylxanthen-9-one	DMIDX7P	Discovery agent	N.A.	Investigative	[21]
1-Naphthalen-2-yl-1H-imidazole	DMTBZJL	Discovery agent	N.A.	Investigative	[22]
1-[(7-Fluoronaphth-2-yl)methyl]-1H-imidazole	DMNJMGK	Discovery agent	N.A.	Investigative	[6]
10-EPI-8-DEOXY-CUMAMBRIN B	DMDQ7Z9	Discovery agent	N.A.	Investigative	[6]
11BETA,13-DIHYDRO-10-EPI-8-DEOXYCUMAM-BRIN B	DM0EPJT	Discovery agent	N.A.	Investigative	[6]
2,3,4-Trimethoxy-4'-amino-trans-stilbene	DMPRF1X	Discovery agent	N.A.	Investigative	[23]
2,3,5-Trimethoxy-4'-amino-trans-stilbene	DMLI5UT	Discovery agent	N.A.	Investigative	[23]
2,3-Dimethoxy-4'-amino-trans-stilbene	DM9C0YZ	Discovery agent	N.A.	Investigative	[23]
2,4-Dimethoxy-3'-amino-trans-stilbene	DMHSLXI	Discovery agent	N.A.	Investigative	[23]
2,4-Dimethoxy-4'-amino-trans-stilbene	DMMZ643	Discovery agent	N.A.	Investigative	[23]
2,5-Dimethoxy-4'-amino-trans-stilbene	DMV0UIR	Discovery agent	N.A.	Investigative	[23]
2-(1H-Imidazol-1-yl)-1-(4-nitrophenyl)ethanone	DMFK9GA	Discovery agent	N.A.	Investigative	[23]
2-(3-hydroxyphenyl)-7-methoxychroman-4-one	DMAH0ZG	Discovery agent	N.A.	Investigative	[17]
2-(4-hydroxyphenyl)-7-methoxychroman-4-one	DMT847Y	Discovery agent	N.A.	Investigative	[17]
2-Imidazol-1-yl-7-methoxy-3-phenyl-chromen-4-one	DM261B0	Discovery agent	N.A.	Investigative	[28]
2-Imidazol-1-ylmethylxanthen-9-one	DM2GUDZ	Discovery agent	N.A.	Investigative	[21]
2-phenyl-2,3-dihydrobenzo[h]chromen-4-one	DMRNZ4X	Discovery agent	N.A.	Investigative	[17]
2-Phenyl-3-pyridin-4-ylmethylene-chroman-4-one	DMKCOS2	Discovery agent	N.A.	Investigative	[29]
2-Phenyl-4-[1,2,4]triazol-1-yl-chroman-7-ol	DMEXYSP	Discovery agent	N.A.	Investigative	[25]
3,4'-(Ethane-1,2-diyl)dibenzenamine	DMFM60H	Discovery agent	N.A.	Investigative	[23]
3,4,5-Trimethoxy-3'-amino-trans-stilbene	DMCA7XU	Discovery agent	N.A.	Investigative	[23]
3,4,5-Trimethoxy-4'-amino-trans-stilbene	DMDBOJ5	Discovery agent	N.A.	Investigative	[23]
3,4-bis(3,4-dimethoxyphenyl)furan-2(5H)-one	DM91W2K	Discovery agent	N.A.	Investigative	[6]
3,4-Dimethoxy-4'-amino-trans-stilbene	DMVDZCE	Discovery agent	N.A.	Investigative	[23]
3,5-Diacetoxy-4'-amino-trans-stilbene	DMEXPIJ	Discovery agent	N.A.	Investigative	[23]
3,5-Diamino-4'-amino-trans-stilbene	DMK9JCA	Discovery agent	N.A.	Investigative	[23]
3,5-Dihydroxyl-4'-amino-trans-stilbene	DMQ9TNB	Discovery agent	N.A.	Investigative	[23]
3,5-Dimethoxy-4'-amino-trans-stilbene	DMC3917	Discovery agent	N.A.	Investigative	[23]
3-((1H-imidazol-1-yl)methyl)-9H-xanthen-9-one	DM491YV	Discovery agent	N.A.	Investigative	[21]
3-(1-ethyl-3,4-dihydronaphthalen-2-yl)-pyridine	DMR7M82	Discovery agent	N.A.	Investigative	[30]
3-(1-methyl-3,4-dihydronaphthalen-2-yl)-pyridine	DMU5HMC	Discovery agent	N.A.	Investigative	[30]
3-(2,2-Diphenyl-vinyl)-pyridine	DMCPOQ9	Discovery agent	N.A.	Investigative	[31]
3-(3,4-dihydronaphthalen-2-yl)pyridine	DM0VL17	Discovery agent	N.A.	Investigative	[30]
3-(3-methyl-3,4-dihydronaphthalen-2-yl)pyridine	DM2YLBD	Discovery agent	N.A.	Investigative	[30]
3-(4-Amino-phenyl)-1-methyl-pyrrolidine-2,5-dione	DMS1LDH	Discovery agent	N.A.	Investigative	[32]
3-(4-Amino-phenyl)-3-butyl-piperidine-2,6-dione	DMD5YKO	Discovery agent	N.A.	Investigative	[33]
3-(4-Amino-phenyl)-3-ethyl-pyrrolidine-2,5-dione	DM3I15D	Discovery agent	N.A.	Investigative	[32]
3-(4-Amino-phenyl)-3-heptyl-piperidine-2,6-dione	DMZ86CS	Discovery agent	N.A.	Investigative	[33]
3-(4-Amino-phenyl)-3-hexyl-piperidine-2,6-dione	DMW62U8	Discovery agent	N.A.	Investigative	[33]
3-(4-Amino-phenyl)-3-methyl-pyrrolidine-2,5-dione	DMITHX5	Discovery agent	N.A.	Investigative	[32]
3-(4-Amino-phenyl)-3-pentyl-piperidine-2,6-dione	DM20DXS	Discovery agent	N.A.	Investigative	[33]
3-(4-Amino-phenyl)-3-propyl-piperidine-2,6-dione	DM39XMT	Discovery agent	N.A.	Investigative	[33]
3-(4-Amino-phenyl)-pyrrolidine-2,5-dione	DMVN0O5	Discovery agent	N.A.	Investigative	[32]
3-(4-methyl-3,4-dihydronaphthalen-2-yl)pyridine	DMDR20P	Discovery agent	N.A.	Investigative	[30]
3-(5-Bromo-6-methoxy-naphthalen-2-yl)-pyridine	DMUIXNS	Discovery agent	N.A.	Investigative	[22]
3-(5-Chloro-6-methoxy-naphthalen-2-yl)-pyridine	DM67DVU	Discovery agent	N.A.	Investigative	[22]
3-(6-Ethoxy-naphthalen-2-yl)-pyridine	DMUQ0WI	Discovery agent	N.A.	Investigative	[22]
3-(6-methoxy-3,4-dihydronaphthalen-2-yl)pyridine	DMAJHXO	Discovery agent	N.A.	Investigative	[30]
3-(6-methoxynaphthalen-2-yl)pyridine	DMYRJAB	Discovery agent	N.A.	Investigative	[34]
3-(imidazolylmethyl)-4'-methoxyflavone	DMM52LC	Discovery agent	N.A.	Investigative	[35]
3-(imidazolylmethyl)-4'-nitroflavone	DMX2LT5	Discovery agent	N.A.	Investigative	[35]
3-(imidazolylmethyl)-7-methoxy-4'-nitroflavone	DML63MX	Discovery agent	N.A.	Investigative	[35]
3-(imidazolylmethyl)flavone	DMLI7F4	Discovery agent	N.A.	Investigative	[35]
3-(naphthalen-2-yl)pyridine	DMJRBT1	Discovery agent	N.A.	Investigative	[34]
3-Amino-4'-amino-trans-stilbene	DMIS3LN	Discovery agent	N.A.	Investigative	[23]
3-Fluoren-9-ylidenemethyl-pyridine	DMR29IQ	Discovery agent	N.A.	Investigative	[31]
3-Fluoro-4'-(pyridin-4-ylmethyl)biphenyl-4-ol	DMJ3WNP	Discovery agent	N.A.	Investigative	[36]
3-Indan-(1E)-ylidenemethyl-pyridine	DMYH6A2	Discovery agent	N.A.	Investigative	[31]
3-Indan-(1Z)-ylidenemethyl-pyridine	DMTQERW	Discovery agent	N.A.	Investigative	[31]
3-Methoxyl-4'-amino-trans-stilbene	DMWNO4D	Discovery agent	N.A.	Investigative	[23]
3-Nitro-4'-nitro-trans-stilbene	DMZRNOT	Discovery agent	N.A.	Investigative	[23]
3-[3-Methyl-indan-(1E)-ylidenemethyl]-pyridine	DMDS8UJ	Discovery agent	N.A.	Investigative	[31]
3-[3-Methyl-indan-(1Z)-ylidenemethyl]-pyridine	DMTF520	Discovery agent	N.A.	Investigative	[31]
3-[3-Phenyl-indan-(1E)-ylidenemethyl]-pyridine	DMYEWA4	Discovery agent	N.A.	Investigative	[31]
3-[4-Chloro-indan-(1E)-ylidenemethyl]-pyridine	DM0XD6T	Discovery agent	N.A.	Investigative	[31]
3-[4-Chloro-indan-(1Z)-ylidenemethyl]-pyridine	DMMDIB9	Discovery agent	N.A.	Investigative	[31]
3-[4-Fluoro-indan-(1E)-ylidenemethyl]-pyridine	DMZS20Y	Discovery agent	N.A.	Investigative	[31]
3-[4-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine	DMPS340	Discovery agent	N.A.	Investigative	[31]
3-[4-Methyl-indan-(1E)-ylidenemethyl]-pyridine	DMJN93U	Discovery agent	N.A.	Investigative	[31]
3-[4-Methyl-indan-(1Z)-ylidenemethyl]-pyridine	DMNILXG	Discovery agent	N.A.	Investigative	[31]
3-[5-Bromo-indan-(1E)-ylidenemethyl]-pyridine	DMUEVAQ	Discovery agent	N.A.	Investigative	[31]
3-[5-Bromo-indan-(1Z)-ylidenemethyl]-pyridine	DMCXSIH	Discovery agent	N.A.	Investigative	[31]
3-[5-Chloro-indan-(1E)-ylidenemethyl]-pyridine	DM8TWLO	Discovery agent	N.A.	Investigative	[31]
3-[5-Chloro-indan-(1Z)-ylidenemethyl]-pyridine	DMN60YG	Discovery agent	N.A.	Investigative	[31]
3-[5-Ethoxy-indan-(1E)-ylidenemethyl]-pyridine	DMLJQZS	Discovery agent	N.A.	Investigative	[31]
3-[5-Ethoxy-indan-(1Z)-ylidenemethyl]-pyridine	DMMTUON	Discovery agent	N.A.	Investigative	[31]
3-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyridine	DMWSFIR	Discovery agent	N.A.	Investigative	[31]
3-[5-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine	DMN42I5	Discovery agent	N.A.	Investigative	[31]
3-[5-Methoxy-indan-(1E)-ylidenemethyl]-pyridine	DM9AW5U	Discovery agent	N.A.	Investigative	[31]
3-[5-Methoxy-indan-(1Z)-ylidenemethyl]-pyridine	DMB3XYE	Discovery agent	N.A.	Investigative	[31]
3-[6-Methoxy-indan-(1E)-ylidenemethyl]-pyridine	DMHT6FX	Discovery agent	N.A.	Investigative	[31]
3-[6-Methyl-indan-(1E)-ylidenemethyl]-pyridine	DMG76LS	Discovery agent	N.A.	Investigative	[31]
3-[6-Methyl-indan-(1Z)-ylidenemethyl]-pyridine	DMKOB2T	Discovery agent	N.A.	Investigative	[31]
3-[7-Methoxy-indan-(1E)-ylidenemethyl]-pyridine	DMVWIQ2	Discovery agent	N.A.	Investigative	[31]
4'-(Pyridin-4-ylmethyl)biphenyl-3,4-diol	DM6Z5EK	Discovery agent	N.A.	Investigative	[36]
4'-(Pyridin-4-ylmethyl)biphenyl-3-amine	DMR8O1B	Discovery agent	N.A.	Investigative	[36]
4'-bromo-3-(imidazolylmethyl)-7-methoxyflavone	DMK2PBJ	Discovery agent	N.A.	Investigative	[35]
4'-bromo-3-(imidazolylmethyl)flavone	DM2V3S8	Discovery agent	N.A.	Investigative	[35]
4'-cyano-3-(imidazolylmethyl)-7-methoxyflavone	DMWGF9R	Discovery agent	N.A.	Investigative	[35]
4'-cyano-3-(imidazolylmethyl)flavone	DMUJS4R	Discovery agent	N.A.	Investigative	[35]
4-((1H-imidazol-1-yl)methyl)-2H-chromen-2-one	DMDHV0N	Discovery agent	N.A.	Investigative	[20]
4-((1H-imidazol-1-yl)methyl)benzonitrile	DMFUBRC	Discovery agent	N.A.	Investigative	[24]
4-(1-Imidazol-1-yl-vinyl)-benzonitrile	DM08963	Discovery agent	N.A.	Investigative	[37]
4-(2,2-Diphenyl-vinyl)-pyridine	DMI638K	Discovery agent	N.A.	Investigative	[31]
4-(2-(1H-imidazol-1-yl)ethoxy)-2H-chromen-2-one	DM1043B	Discovery agent	N.A.	Investigative	[20]
4-(3,4,5-Trimethoxyphenethyl)aniline	DMNUWK2	Discovery agent	N.A.	Investigative	[23]
4-(3,4-Dimethoxyphenethyl)aniline	DMBI7MS	Discovery agent	N.A.	Investigative	[23]
4-(3,5-Dimethoxyphenethyl)benzenamine	DM4FC9O	Discovery agent	N.A.	Investigative	[23]
4-ANDROSTENE-3-17-DIONE	DMSE8NU	Discovery agent	N.A.	Investigative	[38]
4-Bromo-1-imidazol-1-ylmethyl-xanthen-9-one	DMMVASI	Discovery agent	N.A.	Investigative	[26]
4-Fluoren-9-ylidenemethyl-pyridine	DMW9I1X	Discovery agent	N.A.	Investigative	[31]
4-Imidazol-1-yl-2-phenyl-chroman-7-ol	DMJKF17	Discovery agent	N.A.	Investigative	[25]
4-Imidazol-1-ylmethyl-1-nitro-xanthen-9-one	DMZLVIF	Discovery agent	N.A.	Investigative	[26]
4-Imidazol-1-ylmethyl-1-nitrothioxanthen-9-one	DM28DEU	Discovery agent	N.A.	Investigative	[21]
4-Imidazol-1-ylmethyl-2-nitroxanthen-9-one	DM6FMO1	Discovery agent	N.A.	Investigative	[21]
4-Imidazol-1-ylmethyl-3-nitroxanthen-9-one	DM8KZQN	Discovery agent	N.A.	Investigative	[21]
4-Imidazol-1-ylmethylthioxanthen-9-one	DMVUSMP	Discovery agent	N.A.	Investigative	[21]
4-Imidazol-1-ylmethylxanthen-9-one	DMM8HK0	Discovery agent	N.A.	Investigative	[21]
4-Indan-(1E)-ylidenemethyl-pyridine	DMFRCQS	Discovery agent	N.A.	Investigative	[31]
4-Indan-(1Z)-ylidenemethyl-pyridine	DM25DR7	Discovery agent	N.A.	Investigative	[31]
4-[(3'-Hydroxybiphenyl-4-yl)methyl]pyridine	DM04MK7	Discovery agent	N.A.	Investigative	[36]
4-[(4'-Hydroxybiphenyl-4-yl)methyl]pyridine	DMIEMWA	Discovery agent	N.A.	Investigative	[36]
4-[5-Bromo-indan-(1Z)-ylidenemethyl]-pyridine	DMQKHXN	Discovery agent	N.A.	Investigative	[31]
4-[5-Chloro-indan-(1E)-ylidenemethyl]-pyridine	DMZL8KN	Discovery agent	N.A.	Investigative	[31]
4-[5-Chloro-indan-(1Z)-ylidenemethyl]-pyridine	DM1Z3DG	Discovery agent	N.A.	Investigative	[31]
4-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyridine	DMY08FE	Discovery agent	N.A.	Investigative	[31]
4-[5-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine	DMHDZUO	Discovery agent	N.A.	Investigative	[31]
4-[5-Methoxy-indan-(1E)-ylidenemethyl]-pyridine	DM25GS6	Discovery agent	N.A.	Investigative	[31]
4-[5-Methoxy-indan-(1Z)-ylidenemethyl]-pyridine	DMLBX4Q	Discovery agent	N.A.	Investigative	[31]
4-[6-Methoxy-indan-(1E)-ylidenemethyl]-pyridine	DM3IR8Y	Discovery agent	N.A.	Investigative	[31]
4-[6-Methoxy-indan-(1Z)-ylidenemethyl]-pyridine	DMIBZJC	Discovery agent	N.A.	Investigative	[31]
4-[6-Methyl-indan-(1E)-ylidenemethyl]-pyridine	DMYGN1K	Discovery agent	N.A.	Investigative	[31]
4-[6-Methyl-indan-(1Z)-ylidenemethyl]-pyridine	DM5VN3D	Discovery agent	N.A.	Investigative	[31]
5-((1H-imidazol-1-yl)methyl)-7,8-dihydroquinoline	DML4DSG	Discovery agent	N.A.	Investigative	[20]
5-(2-(1H-imidazol-1-yl)ethyl)quinoline	DMA2GIE	Discovery agent	N.A.	Investigative	[20]
5-Bromo-8-imidazol-1-ylmethyl-chromen-4-one	DM09Y72	Discovery agent	N.A.	Investigative	[26]
5-Indan-(1E)-ylidenemethyl-1H-imidazole	DMW8AOM	Discovery agent	N.A.	Investigative	[39]
5-Indan-(1Z)-ylidenemethyl-1H-imidazole	DMKLY20	Discovery agent	N.A.	Investigative	[39]
5-Pyridin-3-yl-1,3-dihydro-2H-indol-2-one	DMLRM9Z	Discovery agent	N.A.	Investigative	[34]
5-Pyridin-3-yl-2,3-dihydro-1H-inden-1-one	DMQYIBC	Discovery agent	N.A.	Investigative	[34]
5-[5-Bromo-indan-(1E)-ylidenemethyl]-1H-imidazole	DMV7QU3	Discovery agent	N.A.	Investigative	[39]
5-[5-Bromo-indan-(1Z)-ylidenemethyl]-1H-imidazole	DMZICL8	Discovery agent	N.A.	Investigative	[39]
5-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyrimidine	DM2RIHT	Discovery agent	N.A.	Investigative	[31]
5-[5-Fluoro-indan-(1Z)-ylidenemethyl]-pyrimidine	DMQGX2Z	Discovery agent	N.A.	Investigative	[31]
5-[5-Methoxy-indan-(1E)-ylidenemethyl]-thiazole	DM5FA74	Discovery agent	N.A.	Investigative	[31]
5-[5-Methoxy-indan-(1Z)-ylidenemethyl]-thiazole	DMPDN63	Discovery agent	N.A.	Investigative	[31]
6-((1H-imidazol-1-yl)methyl)-2H-chromene-2-thione	DMOR04W	Discovery agent	N.A.	Investigative	[20]
6-Imidazol-1-yl-isoquinoline	DMQXL1Y	Discovery agent	N.A.	Investigative	[20]
7,4'-Dihydroxyflavone	DMXQ1K0	Discovery agent	N.A.	Investigative	[6]
7-((1H-imidazol-1-yl)methyl)-2H-chromen-2-one	DM2UTEA	Discovery agent	N.A.	Investigative	[20]
7-((1H-imidazol-1-yl)methyl)-4H-chromen-4-one	DMOS4ZQ	Discovery agent	N.A.	Investigative	[20]
7-((1H-imidazol-1-yl)methyl)isoquinoline	DM9ID4T	Discovery agent	N.A.	Investigative	[20]
7-(2-(1H-imidazol-1-yl)ethoxy)-2H-chromen-2-one	DM4HUO1	Discovery agent	N.A.	Investigative	[40]
7-hydroxy-2-(3-hydroxyphenyl)chroman-4-one	DMXBUNV	Discovery agent	N.A.	Investigative	[17]
7-hydroxy-2-phenylchroman-4-one	DM4UW65	Discovery agent	N.A.	Investigative	[17]
7-[1,2,4]Triazol-4-ylmethyl-chromen-4-one	DMNGLM1	Discovery agent	N.A.	Investigative	[26]
8-Imidazol-1-ylmethyl-5-nitro-chromen-4-one	DMA26L4	Discovery agent	N.A.	Investigative	[26]
9-Hydroxy-7,8-benzoflavone	DMH72MU	Discovery agent	N.A.	Investigative	[6]
ALBANOL A	DMHIW2L	Discovery agent	N.A.	Investigative	[18]
ALPHA-NAPHTHOFLAVONE	DMELOIQ	Discovery agent	N.A.	Investigative	[6]
ANDROSTENEDONE	DMPL0BA	Discovery agent	N.A.	Investigative	[41]
APIGENIN	DMI3491	Discovery agent	N.A.	Investigative	[6]
Benzyl-biphenyl-4-ylmethyl-imidazol-1-yl-amine	DMFB4M5	Discovery agent	N.A.	Investigative	[19]
biochanin A	DM0HPWY	Discovery agent	N.A.	Investigative	[6]
Broussoflavonol F	DMB9SEI	Discovery agent	N.A.	Investigative	[18]
CGS-18320B	DM2CS5A	Discovery agent	N.A.	Investigative	[6]
Chrysin	DM7V2LG	Discovery agent	N.A.	Investigative	[6]
DEHYDROLEUCODIN	DM0V1NH	Discovery agent	N.A.	Investigative	[6]
Docosapentaenoic acid	DMVCP6X	Discovery agent	N.A.	Investigative	[42]
flavone	DMEQH6J	Discovery agent	N.A.	Investigative	[6]
Gamma-mangostin	DMC0OVP	Discovery agent	N.A.	Investigative	[43]
GARCINONE D	DMQDV3U	Discovery agent	N.A.	Investigative	[43]
GOSSYPETIN	DMMT05U	Discovery agent	N.A.	Investigative	[44]
Isogemichalcone C	DM31AXO	Discovery agent	N.A.	Investigative	[18]
ISOLICOFLAVONOL	DMYEGBC	Discovery agent	N.A.	Investigative	[18]
LIQUIRTIGENIN	DM6YSG3	Discovery agent	N.A.	Investigative	[44]
LUDARTIN	DMI9VNO	Discovery agent	N.A.	Investigative	[6]
MDL-18962	DMTVOWC	Discovery agent	N.A.	Investigative	[45]
MONODICTYOCHROMONE B	DM59CR0	Discovery agent	N.A.	Investigative	[46]
MORACHALCONE A	DMWR0J1	Discovery agent	N.A.	Investigative	[18]
MR-16089	DMM2WG7	Discovery agent	N.A.	Investigative	[6]
MR-20492	DMEBQLK	Discovery agent	N.A.	Investigative	[6]
MR-20494	DMC79YF	Discovery agent	N.A.	Investigative	[6]
MR-20496	DMTCG8M	Discovery agent	N.A.	Investigative	[47]
MR-20814	DMSR3OI	Discovery agent	N.A.	Investigative	[47]
N-(2-benzyloxy-4-nitrophenyl)methanesulfonamide	DMW5XLG	Discovery agent	N.A.	Investigative	[48]
N-(2-hexyloxy-4-nitrophenyl)methanesulfonamide	DM27L53	Discovery agent	N.A.	Investigative	[49]
N-(2-nonyloxy-4-nitrophenyl)methanesulfonamide	DMU6FPL	Discovery agent	N.A.	Investigative	[49]
N-(2-Propyloxy-4-nitrophenyl)methanesulfonamide	DMAQMXJ	Discovery agent	N.A.	Investigative	[49]
N-[2-(4'-Nitrophenyl)ethyl]-imidazole	DMPKBT1	Discovery agent	N.A.	Investigative	[6]
NSC-122427	DMYMB4A	Discovery agent	N.A.	Investigative	[50]
NSC-12999	DMJAO6Z	Discovery agent	N.A.	Investigative	[20]
NSC-131736	DMYJNS9	Discovery agent	N.A.	Investigative	[20]
NSC-289311	DMZU1L0	Discovery agent	N.A.	Investigative	[20]
NSC-356483	DMEK5B2	Discovery agent	N.A.	Investigative	[20]
NSC-356781	DM9LI7M	Discovery agent	N.A.	Investigative	[20]
NSC-368272	DMR97X3	Discovery agent	N.A.	Investigative	[20]
NSC-368280	DMR3IP5	Discovery agent	N.A.	Investigative	[20]
NSC-369087	DMAQWM8	Discovery agent	N.A.	Investigative	[20]
NSC-613604	DMD1XM0	Discovery agent	N.A.	Investigative	[50]
NSC-625409	DM0GWAC	Discovery agent	N.A.	Investigative	[20]
NSC-666292	DMNMF0C	Discovery agent	N.A.	Investigative	[20]
NSC-683634	DMZ2KUB	Discovery agent	N.A.	Investigative	[20]
NSC-75308	DM8GZAM	Discovery agent	N.A.	Investigative	[20]
NSC-93358	DMTOFS7	Discovery agent	N.A.	Investigative	[50]
NSC-94258	DM6VY3P	Discovery agent	N.A.	Investigative	[6]
NSC-94891	DM31CZK	Discovery agent	N.A.	Investigative	[50]
Org-33201	DMDY38R	Discovery agent	N.A.	Investigative	[51]
------------------------------------------------------------------------------------


⏷ Show the Full List of 220 Investigative Drug(s)

References

1	Aminoglutethimide-induced protein free radical formation on myeloperoxidase: a potential mechanism of agranulocytosis. Chem Res Toxicol. 2007 Jul;20(7):1038-45.
2	Effective aromatase inhibition by anastrozole in a patient with gonadotropin-independent precocious puberty in McCune-Albright syndrome. J Pediatr Endocrinol Metab. 2002;15 Suppl 3:945-8.
3	Aromatase inhibitors--theoretical concept and present experiences in the treatment of endometriosis. Zentralbl Gynakol. 2003 Jul-Aug;125(7-8):247-51.
4	Enantioselective nonsteroidal aromatase inhibitors identified through a multidisciplinary medicinal chemistry approach. J Med Chem. 2005 Nov 17;48(23):7282-9.
5	Aromatase inhibitors for male infertility. J Urol. 2002 Feb;167(2 Pt 1):624-9.
6	Pharmacophore modeling strategies for the development of novel nonsteroidal inhibitors of human aromatase (CYP19). Bioorg Med Chem Lett. 2010 May 15;20(10):3050-64.
7	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032111)
8	Highly potent first examples of dual aromatase-steroid sulfatase inhibitors based on a biphenyl template. J Med Chem. 2010 Mar 11;53(5):2155-70.
9	The taiwaniaquinoids: a review. J Nat Prod. 2010 Feb 26;73(2):284-98.
10	Pharmacokinetics of finrozole (MPV-2213ad), a novel selective aromatase inhibitor, in healthy men. Br J Clin Pharmacol. 2001 Dec;52(6):702-4.
11	Effects of aromatase inhibitors on the pathobiology of the human breast, endometrial and ovarian carcinoma. Endocr Relat Cancer. 1999 Jun;6(2):197-204.
12	Chiral aromatase and dual aromatase-steroid sulfatase inhibitors from the letrozole template: synthesis, absolute configuration, and in vitro activ... J Med Chem. 2008 Jul 24;51(14):4226-38.
13	First dual aromatase-steroid sulfatase inhibitors. J Med Chem. 2003 Jul 17;46(15):3193-6.
14	High-performance liquid chromatographic determination of FCE 24928, a new aromatase inhibitor, in human plasma. J Chromatogr A. 1994 Feb 4;660(1-2):293-8.
15	Analogues of 3-ethyl-3-(4-pyridyl)piperidine-2,6-dione as selective inhibitors of aromatase: derivatives with variable 1-alkyl and 3-alkyl substitu... J Med Chem. 1987 Sep;30(9):1550-4.
16	Synthesis and biological evaluation of (+/-)-abyssinone II and its analogues as aromatase inhibitors for chemoprevention of breast cancer. J Med Chem. 2007 Jun 14;50(12):2799-806.
17	New 7,8-benzoflavanones as potent aromatase inhibitors: synthesis and biological evaluation. Bioorg Med Chem. 2008 Feb 1;16(3):1474-80.
18	Aromatase inhibitors from Broussonetia papyrifera. J Nat Prod. 2001 Oct;64(10):1286-93.
19	CYP19 (aromatase): exploring the scaffold flexibility for novel selective inhibitors. Bioorg Med Chem. 2008 Sep 15;16(18):8349-58.
20	Fast three dimensional pharmacophore virtual screening of new potent non-steroid aromatase inhibitors. J Med Chem. 2009 Jan 8;52(1):143-50.
21	Novel highly potent and selective nonsteroidal aromatase inhibitors: synthesis, biological evaluation and structure-activity relationships investigation. J Med Chem. 2010 Jul 22;53(14):5347-51.
22	Heteroaryl-substituted naphthalenes and structurally modified derivatives: selective inhibitors of CYP11B2 for the treatment of congestive heart fa... J Med Chem. 2005 Oct 20;48(21):6632-42.
23	Design, synthesis, and biological evaluation of resveratrol analogues as aromatase and quinone reductase 2 inhibitors for chemoprevention of cancer. Bioorg Med Chem. 2010 Jul 15;18(14):5352-66.
24	Fadrozole hydrochloride: a potent, selective, nonsteroidal inhibitor of aromatase for the treatment of estrogen-dependent disease. J Med Chem. 1991 Feb;34(2):725-36.
25	Synthesis and evaluation of 4-triazolylflavans as new aromatase inhibitors. Bioorg Med Chem Lett. 2004 Oct 18;14(20):5215-8.
26	A new class of nonsteroidal aromatase inhibitors: design and synthesis of chromone and xanthone derivatives and inhibition of the P450 enzymes aromatase and 17 alpha-hydroxylase/C17,20-lyase. J Med Chem. 2001 Mar 1;44(5):672-80.
27	New selective nonsteroidal aromatase inhibitors: synthesis and inhibitory activity of 2,3 or 5-(alpha-azolylbenzyl)-1H-indoles. Bioorg Med Chem Lett. 1999 Feb 8;9(3):333-6.
28	Synthesis and characterization of azole isoflavone inhibitors of aromatase. Bioorg Med Chem. 2005 Jun 2;13(12):4063-70.
29	New aromatase inhibitors. Synthesis and inhibitory activity of pyridinyl-substituted flavanone derivatives. Bioorg Med Chem Lett. 2002 Apr 8;12(7):1059-61.
30	Synthesis and evaluation of heteroaryl-substituted dihydronaphthalenes and indenes: potent and selective inhibitors of aldosterone synthase (CYP11B... J Med Chem. 2006 Apr 6;49(7):2222-31.
31	Synthesis and evaluation of (pyridylmethylene)tetrahydronaphthalenes/-indanes and structurally modified derivatives: potent and selective inhibitor... J Med Chem. 2005 Mar 10;48(5):1563-75.
32	Synthesis and biochemical evaluation of analogues of aminoglutethimide based on phenylpyrrolidine-2,5-dione. J Med Chem. 1986 Apr;29(4):520-3.
33	Aromatase inhibitors. Synthesis and evaluation of mammary tumor inhibiting activity of 3-alkylated 3-(4-aminophenyl)piperidine-2,6-diones. J Med Chem. 1986 Aug;29(8):1362-9.
34	In vivo active aldosterone synthase inhibitors with improved selectivity: lead optimization providing a series of pyridine substituted 3,4-dihydro-... J Med Chem. 2008 Dec 25;51(24):8077-87.
35	Lead optimization providing a series of flavone derivatives as potent nonsteroidal inhibitors of the cytochrome P450 aromatase enzyme. J Med Chem. 2006 Jul 27;49(15):4777-80.
36	Replacement of imidazolyl by pyridyl in biphenylmethylenes results in selective CYP17 and dual CYP17/CYP11B1 inhibitors for the treatment of prosta... J Med Chem. 2010 Aug 12;53(15):5749-58.
37	Aromatase inhibitors: synthesis, biological activity, and binding mode of azole-type compounds. J Med Chem. 1993 May 14;36(10):1393-400.
38	The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
39	Synthesis and evaluation of imidazolylmethylenetetrahydronaphthalenes and imidazolylmethyleneindanes: potent inhibitors of aldosterone synthase. J Med Chem. 2005 Mar 24;48(6):1796-805.
40	Design, synthesis, and 3D QSAR of novel potent and selective aromatase inhibitors. J Med Chem. 2004 Dec 30;47(27):6792-803.
41	Effects of steroid D-ring modification on suicide inactivation and competitive inhibition of aromatase by analogues of androsta-1,4-diene-3,17-dione. J Med Chem. 1989 Mar;32(3):651-8.
42	Interference by naturally occurring fatty acids in a noncellular enzyme-based aromatase bioassay. J Nat Prod. 2006 Apr;69(4):700-3.
43	Xanthones from the botanical dietary supplement mangosteen (Garcinia mangostana) with aromatase inhibitory activity. J Nat Prod. 2008 Jul;71(7):1161-6.
44	Screening of herbal constituents for aromatase inhibitory activity. Bioorg Med Chem. 2008 Sep 15;16(18):8466-70.
45	6 beta-Propynyl-substituted steroids: mechanism-based enzyme-activated irreversible inhibitors of aromatase. J Med Chem. 1997 Sep 26;40(20):3263-70.
46	Monodictyochromes A and B, dimeric xanthone derivatives from the marine algicolous fungus Monodictys putredinis. J Nat Prod. 2008 Nov;71(11):1793-9.
47	Design and synthesis of a new type of non steroidal human aromatase inhibitors. Bioorg Med Chem Lett. 1998 May 5;8(9):1041-4.
48	Synthesis and biological evaluation of selective aromatase expression regulators in breast cancer cells. J Med Chem. 2007 Apr 5;50(7):1635-44.
49	Novel sulfonanilide analogues suppress aromatase expression and activity in breast cancer cells independent of COX-2 inhibition. J Med Chem. 2006 Feb 23;49(4):1413-9.
50	An efficient steroid pharmacophore-based strategy to identify new aromatase inhibitors. Eur J Med Chem. 2009 Oct;44(10):4121-7.
51	Org 33201: a new highly selective orally active aromatase inhibitor. J Steroid Biochem Mol Biol. 1993 Mar;44(4-6):681-2.
52	Double-blind, randomised, multicentre endocrine trial comparing two letrozole doses, in postmenopausal breast cancer patients. Eur J Cancer. 1999 Feb;35(2):208-13.
53	N-demethylation of levo-alpha-acetylmethadol by human placental aromatase. Biochem Pharmacol. 2004 Mar 1;67(5):885-92.
54	Bidirectional transfer of methadone across human placenta. Biochem Pharmacol. 2005 Jan 1;69(1):187-97.
55	Aromatization of testosterone and 19-nortestosterone by a single enzyme from equine testicular microsomes. Differences from human placental aromatase. J Steroid Biochem. 1988 Jan;29(1):119-25.
56	Urinary and serum octopamine in patients with portal-systemic encephalopathy. Lancet. 1975 Nov 15;2(7942):943-6.
57	Loss of aromatase cytochrome P450 function as a risk factor for Parkinson's disease? Brain Res Rev. 2008 Mar;57(2):431-43.
58	Identifying susceptibility genes for prostate cancer--a family-based association study of polymorphisms in CYP17, CYP19, CYP11A1, and LH-beta. Cancer Epidemiol Biomarkers Prev. 2005 Aug;14(8):2035-9.