General Information of Drug Therapeutic Target (DTT) (ID: TTSZLWK)

DTT Name Aromatase (CYP19A1)
Synonyms P-450AROM; Estrogen synthetase; Estrogen synthase; Cytochrome P450 19A1; Cytochrome P-450AROM; CYPXIX; CYP19; CYAR; ARO1
Gene Name CYP19A1
DTT Type
Successful target
[1]
BioChemical Class
Paired donor oxygen oxidoreductase
UniProt ID
CP19A_HUMAN
TTD ID
T13260
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
EC 1.14.14.14
Sequence
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI
SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL
GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN
ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL
YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI
YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH
PDETKNMLEMIFTPRNSDRCLEH
Function Catalyzes the formation of aromatic C18 estrogens from C19 androgens.
KEGG Pathway
Steroid hormone biosynthesis (hsa00140 )
Metabolic pathways (hsa01100 )
Ovarian steroidogenesis (hsa04913 )
Reactome Pathway
Endogenous sterols (R-HSA-211976 )
BioCyc Pathway
MetaCyc:HS06413-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
6 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Aminoglutethimide DMWFHMZ Cushing disease 5A70 Approved [1]
Anastrozole DMNP60F Breast cancer 2C60-2C65 Approved [2]
Exemestane DM9HPW3 Hormonally-responsive breast cancer 2C60-2C65 Approved [3]
FADROZOLE DM3C5GZ Breast cancer 2C60-2C65 Approved [4]
Letrozole DMH07Y3 Estrogen-receptor positive breast cancer Approved [3]
Testolactone DMVY4GN Breast cancer 2C60-2C65 Approved [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Approved Drug(s)
4 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
LIAROZOLE DM4OYXE Dermatological disease DA24.Y Phase 2/3 [6]
BGS-649 DMO4MNQ Endometriosis GA10 Phase 2 [7]
Coumate DMVKW0N Breast cancer 2C60-2C65 Phase 2 [8]
NARINGENIN DMHAZLM N. A. N. A. Phase 1 [6]
------------------------------------------------------------------------------------
7 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
FORMESTANE DMWIDJK Breast cancer 2C60-2C65 Withdrawn from market [9]
FINROZOLE DM06SC9 Prostate disease GA91 Discontinued in Phase 2 [10]
NKS-01 DMV5FN1 Bladder cancer 2C94 Discontinued in Phase 2 [11]
VOROZOLE DM32N5G N. A. N. A. Discontinued in Phase 2 [12]
YM-511 DM7WDAG Breast cancer 2C60-2C65 Discontinued in Phase 2 [13]
MINAMESTANE DM7IXH3 Bladder cancer 2C94 Terminated [14]
Rogletimide DM6JO30 Breast cancer 2C60-2C65 Terminated [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Discontinued Drug(s)
220 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(+/-)-7-methoxy-2-(4-methoxyphenyl)chroman-4-one DMYJGDK Discovery agent N.A. Investigative [16]
(+/-)-7-methoxy-2-phenylchroman-4-one DMC0OKA Discovery agent N.A. Investigative [17]
(2S)-5,7,2',4'-tetrahydroxyflavanone DMYVBHT Discovery agent N.A. Investigative [18]
(2S)-abyssinone II DM5V3M1 Discovery agent N.A. Investigative [18]
(2S)-euchrenone a7 DM6L0KZ Discovery agent N.A. Investigative [18]
1-(1-Benzyl-2-biphenyl-4-yl-ethyl)-1H-imidazole DMLBCE5 Discovery agent N.A. Investigative [19]
1-(2-(benzo[b]thiophen-4-yl)ethyl)-1H-imidazole DMB3HI4 Discovery agent N.A. Investigative [20]
1-(2-phenoxybenzyl)-1H-imidazole DMLY4ER Discovery agent N.A. Investigative [21]
1-(3-(4-fluorophenyl)propyl)-1H-imidazole DMWKXZ2 Discovery agent N.A. Investigative [6]
1-(3-Methoxy-naphthalen-2-yl)-1H-imidazole DM16U5F Discovery agent N.A. Investigative [22]
1-(4-Aminophenyl)-2-(1H-imidazol-1-yl)ethanone DMMYT4W Discovery agent N.A. Investigative [23]
1-(4-Cyanobenzyl)-5-methyl-1H-imidazole DMKC52N Discovery agent N.A. Investigative [24]
1-(4-nitro-2-phenoxybenzyl)-1H-imidazole DMSRBUE Discovery agent N.A. Investigative [21]
1-(4-Nitro-2-phenylsulfanylbenzyl)-1H-imidazole DMCP089 Discovery agent N.A. Investigative [21]
1-(7-Methoxy-2-phenyl-chroman-4-yl)-1H-imidazole DMLHDE3 Discovery agent N.A. Investigative [25]
1-(9-phenyl-9H-fluoren-9-yl)-1H-1,2,4-triazole DMVJZ0C Discovery agent N.A. Investigative [20]
1-(9-Phenyl-9H-fluoren-9-yl)1H-imidazole DMLIJYS Discovery agent N.A. Investigative [6]
1-(9H-fluoren-9-yl)-1H-imidazole DMH49OD Discovery agent N.A. Investigative [20]
1-(biphenyl-3-ylmethyl)-1H-1,2,4-triazole DMGVPMT Discovery agent N.A. Investigative [8]
1-Bromo-4-imidazol-1-ylmethyl-xanthen-9-one DMGL4MJ Discovery agent N.A. Investigative [26]
1-Ethyl-5-(imidazol-1-yl-phenyl-methyl)-1H-indole DMUOSJG Discovery agent N.A. Investigative [27]
1-Imidazol-1-ylmethyl-4-nitro-xanthen-9-one DMN7KHS Discovery agent N.A. Investigative [26]
1-Imidazol-1-ylmethylxanthen-9-one DMIDX7P Discovery agent N.A. Investigative [21]
1-Naphthalen-2-yl-1H-imidazole DMTBZJL Discovery agent N.A. Investigative [22]
1-[(7-Fluoronaphth-2-yl)methyl]-1H-imidazole DMNJMGK Discovery agent N.A. Investigative [6]
10-EPI-8-DEOXY-CUMAMBRIN B DMDQ7Z9 Discovery agent N.A. Investigative [6]
11BETA,13-DIHYDRO-10-EPI-8-DEOXYCUMAM-BRIN B DM0EPJT Discovery agent N.A. Investigative [6]
2,3,4-Trimethoxy-4'-amino-trans-stilbene DMPRF1X Discovery agent N.A. Investigative [23]
2,3,5-Trimethoxy-4'-amino-trans-stilbene DMLI5UT Discovery agent N.A. Investigative [23]
2,3-Dimethoxy-4'-amino-trans-stilbene DM9C0YZ Discovery agent N.A. Investigative [23]
2,4-Dimethoxy-3'-amino-trans-stilbene DMHSLXI Discovery agent N.A. Investigative [23]
2,4-Dimethoxy-4'-amino-trans-stilbene DMMZ643 Discovery agent N.A. Investigative [23]
2,5-Dimethoxy-4'-amino-trans-stilbene DMV0UIR Discovery agent N.A. Investigative [23]
2-(1H-Imidazol-1-yl)-1-(4-nitrophenyl)ethanone DMFK9GA Discovery agent N.A. Investigative [23]
2-(3-hydroxyphenyl)-7-methoxychroman-4-one DMAH0ZG Discovery agent N.A. Investigative [17]
2-(4-hydroxyphenyl)-7-methoxychroman-4-one DMT847Y Discovery agent N.A. Investigative [17]
2-Imidazol-1-yl-7-methoxy-3-phenyl-chromen-4-one DM261B0 Discovery agent N.A. Investigative [28]
2-Imidazol-1-ylmethylxanthen-9-one DM2GUDZ Discovery agent N.A. Investigative [21]
2-phenyl-2,3-dihydrobenzo[h]chromen-4-one DMRNZ4X Discovery agent N.A. Investigative [17]
2-Phenyl-3-pyridin-4-ylmethylene-chroman-4-one DMKCOS2 Discovery agent N.A. Investigative [29]
2-Phenyl-4-[1,2,4]triazol-1-yl-chroman-7-ol DMEXYSP Discovery agent N.A. Investigative [25]
3,4'-(Ethane-1,2-diyl)dibenzenamine DMFM60H Discovery agent N.A. Investigative [23]
3,4,5-Trimethoxy-3'-amino-trans-stilbene DMCA7XU Discovery agent N.A. Investigative [23]
3,4,5-Trimethoxy-4'-amino-trans-stilbene DMDBOJ5 Discovery agent N.A. Investigative [23]
3,4-bis(3,4-dimethoxyphenyl)furan-2(5H)-one DM91W2K Discovery agent N.A. Investigative [6]
3,4-Dimethoxy-4'-amino-trans-stilbene DMVDZCE Discovery agent N.A. Investigative [23]
3,5-Diacetoxy-4'-amino-trans-stilbene DMEXPIJ Discovery agent N.A. Investigative [23]
3,5-Diamino-4'-amino-trans-stilbene DMK9JCA Discovery agent N.A. Investigative [23]
3,5-Dihydroxyl-4'-amino-trans-stilbene DMQ9TNB Discovery agent N.A. Investigative [23]
3,5-Dimethoxy-4'-amino-trans-stilbene DMC3917 Discovery agent N.A. Investigative [23]
3-((1H-imidazol-1-yl)methyl)-9H-xanthen-9-one DM491YV Discovery agent N.A. Investigative [21]
3-(1-ethyl-3,4-dihydronaphthalen-2-yl)-pyridine DMR7M82 Discovery agent N.A. Investigative [30]
3-(1-methyl-3,4-dihydronaphthalen-2-yl)-pyridine DMU5HMC Discovery agent N.A. Investigative [30]
3-(2,2-Diphenyl-vinyl)-pyridine DMCPOQ9 Discovery agent N.A. Investigative [31]
3-(3,4-dihydronaphthalen-2-yl)pyridine DM0VL17 Discovery agent N.A. Investigative [30]
3-(3-methyl-3,4-dihydronaphthalen-2-yl)pyridine DM2YLBD Discovery agent N.A. Investigative [30]
3-(4-Amino-phenyl)-1-methyl-pyrrolidine-2,5-dione DMS1LDH Discovery agent N.A. Investigative [32]
3-(4-Amino-phenyl)-3-butyl-piperidine-2,6-dione DMD5YKO Discovery agent N.A. Investigative [33]
3-(4-Amino-phenyl)-3-ethyl-pyrrolidine-2,5-dione DM3I15D Discovery agent N.A. Investigative [32]
3-(4-Amino-phenyl)-3-heptyl-piperidine-2,6-dione DMZ86CS Discovery agent N.A. Investigative [33]
3-(4-Amino-phenyl)-3-hexyl-piperidine-2,6-dione DMW62U8 Discovery agent N.A. Investigative [33]
3-(4-Amino-phenyl)-3-methyl-pyrrolidine-2,5-dione DMITHX5 Discovery agent N.A. Investigative [32]
3-(4-Amino-phenyl)-3-pentyl-piperidine-2,6-dione DM20DXS Discovery agent N.A. Investigative [33]
3-(4-Amino-phenyl)-3-propyl-piperidine-2,6-dione DM39XMT Discovery agent N.A. Investigative [33]
3-(4-Amino-phenyl)-pyrrolidine-2,5-dione DMVN0O5 Discovery agent N.A. Investigative [32]
3-(4-methyl-3,4-dihydronaphthalen-2-yl)pyridine DMDR20P Discovery agent N.A. Investigative [30]
3-(5-Bromo-6-methoxy-naphthalen-2-yl)-pyridine DMUIXNS Discovery agent N.A. Investigative [22]
3-(5-Chloro-6-methoxy-naphthalen-2-yl)-pyridine DM67DVU Discovery agent N.A. Investigative [22]
3-(6-Ethoxy-naphthalen-2-yl)-pyridine DMUQ0WI Discovery agent N.A. Investigative [22]
3-(6-methoxy-3,4-dihydronaphthalen-2-yl)pyridine DMAJHXO Discovery agent N.A. Investigative [30]
3-(6-methoxynaphthalen-2-yl)pyridine DMYRJAB Discovery agent N.A. Investigative [34]
3-(imidazolylmethyl)-4'-methoxyflavone DMM52LC Discovery agent N.A. Investigative [35]
3-(imidazolylmethyl)-4'-nitroflavone DMX2LT5 Discovery agent N.A. Investigative [35]
3-(imidazolylmethyl)-7-methoxy-4'-nitroflavone DML63MX Discovery agent N.A. Investigative [35]
3-(imidazolylmethyl)flavone DMLI7F4 Discovery agent N.A. Investigative [35]
3-(naphthalen-2-yl)pyridine DMJRBT1 Discovery agent N.A. Investigative [34]
3-Amino-4'-amino-trans-stilbene DMIS3LN Discovery agent N.A. Investigative [23]
3-Fluoren-9-ylidenemethyl-pyridine DMR29IQ Discovery agent N.A. Investigative [31]
3-Fluoro-4'-(pyridin-4-ylmethyl)biphenyl-4-ol DMJ3WNP Discovery agent N.A. Investigative [36]
3-Indan-(1E)-ylidenemethyl-pyridine DMYH6A2 Discovery agent N.A. Investigative [31]
3-Indan-(1Z)-ylidenemethyl-pyridine DMTQERW Discovery agent N.A. Investigative [31]
3-Methoxyl-4'-amino-trans-stilbene DMWNO4D Discovery agent N.A. Investigative [23]
3-Nitro-4'-nitro-trans-stilbene DMZRNOT Discovery agent N.A. Investigative [23]
3-[3-Methyl-indan-(1E)-ylidenemethyl]-pyridine DMDS8UJ Discovery agent N.A. Investigative [31]
3-[3-Methyl-indan-(1Z)-ylidenemethyl]-pyridine DMTF520 Discovery agent N.A. Investigative [31]
3-[3-Phenyl-indan-(1E)-ylidenemethyl]-pyridine DMYEWA4 Discovery agent N.A. Investigative [31]
3-[4-Chloro-indan-(1E)-ylidenemethyl]-pyridine DM0XD6T Discovery agent N.A. Investigative [31]
3-[4-Chloro-indan-(1Z)-ylidenemethyl]-pyridine DMMDIB9 Discovery agent N.A. Investigative [31]
3-[4-Fluoro-indan-(1E)-ylidenemethyl]-pyridine DMZS20Y Discovery agent N.A. Investigative [31]
3-[4-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine DMPS340 Discovery agent N.A. Investigative [31]
3-[4-Methyl-indan-(1E)-ylidenemethyl]-pyridine DMJN93U Discovery agent N.A. Investigative [31]
3-[4-Methyl-indan-(1Z)-ylidenemethyl]-pyridine DMNILXG Discovery agent N.A. Investigative [31]
3-[5-Bromo-indan-(1E)-ylidenemethyl]-pyridine DMUEVAQ Discovery agent N.A. Investigative [31]
3-[5-Bromo-indan-(1Z)-ylidenemethyl]-pyridine DMCXSIH Discovery agent N.A. Investigative [31]
3-[5-Chloro-indan-(1E)-ylidenemethyl]-pyridine DM8TWLO Discovery agent N.A. Investigative [31]
3-[5-Chloro-indan-(1Z)-ylidenemethyl]-pyridine DMN60YG Discovery agent N.A. Investigative [31]
3-[5-Ethoxy-indan-(1E)-ylidenemethyl]-pyridine DMLJQZS Discovery agent N.A. Investigative [31]
3-[5-Ethoxy-indan-(1Z)-ylidenemethyl]-pyridine DMMTUON Discovery agent N.A. Investigative [31]
3-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyridine DMWSFIR Discovery agent N.A. Investigative [31]
3-[5-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine DMN42I5 Discovery agent N.A. Investigative [31]
3-[5-Methoxy-indan-(1E)-ylidenemethyl]-pyridine DM9AW5U Discovery agent N.A. Investigative [31]
3-[5-Methoxy-indan-(1Z)-ylidenemethyl]-pyridine DMB3XYE Discovery agent N.A. Investigative [31]
3-[6-Methoxy-indan-(1E)-ylidenemethyl]-pyridine DMHT6FX Discovery agent N.A. Investigative [31]
3-[6-Methyl-indan-(1E)-ylidenemethyl]-pyridine DMG76LS Discovery agent N.A. Investigative [31]
3-[6-Methyl-indan-(1Z)-ylidenemethyl]-pyridine DMKOB2T Discovery agent N.A. Investigative [31]
3-[7-Methoxy-indan-(1E)-ylidenemethyl]-pyridine DMVWIQ2 Discovery agent N.A. Investigative [31]
4'-(Pyridin-4-ylmethyl)biphenyl-3,4-diol DM6Z5EK Discovery agent N.A. Investigative [36]
4'-(Pyridin-4-ylmethyl)biphenyl-3-amine DMR8O1B Discovery agent N.A. Investigative [36]
4'-bromo-3-(imidazolylmethyl)-7-methoxyflavone DMK2PBJ Discovery agent N.A. Investigative [35]
4'-bromo-3-(imidazolylmethyl)flavone DM2V3S8 Discovery agent N.A. Investigative [35]
4'-cyano-3-(imidazolylmethyl)-7-methoxyflavone DMWGF9R Discovery agent N.A. Investigative [35]
4'-cyano-3-(imidazolylmethyl)flavone DMUJS4R Discovery agent N.A. Investigative [35]
4-((1H-imidazol-1-yl)methyl)-2H-chromen-2-one DMDHV0N Discovery agent N.A. Investigative [20]
4-((1H-imidazol-1-yl)methyl)benzonitrile DMFUBRC Discovery agent N.A. Investigative [24]
4-(1-Imidazol-1-yl-vinyl)-benzonitrile DM08963 Discovery agent N.A. Investigative [37]
4-(2,2-Diphenyl-vinyl)-pyridine DMI638K Discovery agent N.A. Investigative [31]
4-(2-(1H-imidazol-1-yl)ethoxy)-2H-chromen-2-one DM1043B Discovery agent N.A. Investigative [20]
4-(3,4,5-Trimethoxyphenethyl)aniline DMNUWK2 Discovery agent N.A. Investigative [23]
4-(3,4-Dimethoxyphenethyl)aniline DMBI7MS Discovery agent N.A. Investigative [23]
4-(3,5-Dimethoxyphenethyl)benzenamine DM4FC9O Discovery agent N.A. Investigative [23]
4-ANDROSTENE-3-17-DIONE DMSE8NU Discovery agent N.A. Investigative [38]
4-Bromo-1-imidazol-1-ylmethyl-xanthen-9-one DMMVASI Discovery agent N.A. Investigative [26]
4-Fluoren-9-ylidenemethyl-pyridine DMW9I1X Discovery agent N.A. Investigative [31]
4-Imidazol-1-yl-2-phenyl-chroman-7-ol DMJKF17 Discovery agent N.A. Investigative [25]
4-Imidazol-1-ylmethyl-1-nitro-xanthen-9-one DMZLVIF Discovery agent N.A. Investigative [26]
4-Imidazol-1-ylmethyl-1-nitrothioxanthen-9-one DM28DEU Discovery agent N.A. Investigative [21]
4-Imidazol-1-ylmethyl-2-nitroxanthen-9-one DM6FMO1 Discovery agent N.A. Investigative [21]
4-Imidazol-1-ylmethyl-3-nitroxanthen-9-one DM8KZQN Discovery agent N.A. Investigative [21]
4-Imidazol-1-ylmethylthioxanthen-9-one DMVUSMP Discovery agent N.A. Investigative [21]
4-Imidazol-1-ylmethylxanthen-9-one DMM8HK0 Discovery agent N.A. Investigative [21]
4-Indan-(1E)-ylidenemethyl-pyridine DMFRCQS Discovery agent N.A. Investigative [31]
4-Indan-(1Z)-ylidenemethyl-pyridine DM25DR7 Discovery agent N.A. Investigative [31]
4-[(3'-Hydroxybiphenyl-4-yl)methyl]pyridine DM04MK7 Discovery agent N.A. Investigative [36]
4-[(4'-Hydroxybiphenyl-4-yl)methyl]pyridine DMIEMWA Discovery agent N.A. Investigative [36]
4-[5-Bromo-indan-(1Z)-ylidenemethyl]-pyridine DMQKHXN Discovery agent N.A. Investigative [31]
4-[5-Chloro-indan-(1E)-ylidenemethyl]-pyridine DMZL8KN Discovery agent N.A. Investigative [31]
4-[5-Chloro-indan-(1Z)-ylidenemethyl]-pyridine DM1Z3DG Discovery agent N.A. Investigative [31]
4-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyridine DMY08FE Discovery agent N.A. Investigative [31]
4-[5-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine DMHDZUO Discovery agent N.A. Investigative [31]
4-[5-Methoxy-indan-(1E)-ylidenemethyl]-pyridine DM25GS6 Discovery agent N.A. Investigative [31]
4-[5-Methoxy-indan-(1Z)-ylidenemethyl]-pyridine DMLBX4Q Discovery agent N.A. Investigative [31]
4-[6-Methoxy-indan-(1E)-ylidenemethyl]-pyridine DM3IR8Y Discovery agent N.A. Investigative [31]
4-[6-Methoxy-indan-(1Z)-ylidenemethyl]-pyridine DMIBZJC Discovery agent N.A. Investigative [31]
4-[6-Methyl-indan-(1E)-ylidenemethyl]-pyridine DMYGN1K Discovery agent N.A. Investigative [31]
4-[6-Methyl-indan-(1Z)-ylidenemethyl]-pyridine DM5VN3D Discovery agent N.A. Investigative [31]
5-((1H-imidazol-1-yl)methyl)-7,8-dihydroquinoline DML4DSG Discovery agent N.A. Investigative [20]
5-(2-(1H-imidazol-1-yl)ethyl)quinoline DMA2GIE Discovery agent N.A. Investigative [20]
5-Bromo-8-imidazol-1-ylmethyl-chromen-4-one DM09Y72 Discovery agent N.A. Investigative [26]
5-Indan-(1E)-ylidenemethyl-1H-imidazole DMW8AOM Discovery agent N.A. Investigative [39]
5-Indan-(1Z)-ylidenemethyl-1H-imidazole DMKLY20 Discovery agent N.A. Investigative [39]
5-Pyridin-3-yl-1,3-dihydro-2H-indol-2-one DMLRM9Z Discovery agent N.A. Investigative [34]
5-Pyridin-3-yl-2,3-dihydro-1H-inden-1-one DMQYIBC Discovery agent N.A. Investigative [34]
5-[5-Bromo-indan-(1E)-ylidenemethyl]-1H-imidazole DMV7QU3 Discovery agent N.A. Investigative [39]
5-[5-Bromo-indan-(1Z)-ylidenemethyl]-1H-imidazole DMZICL8 Discovery agent N.A. Investigative [39]
5-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyrimidine DM2RIHT Discovery agent N.A. Investigative [31]
5-[5-Fluoro-indan-(1Z)-ylidenemethyl]-pyrimidine DMQGX2Z Discovery agent N.A. Investigative [31]
5-[5-Methoxy-indan-(1E)-ylidenemethyl]-thiazole DM5FA74 Discovery agent N.A. Investigative [31]
5-[5-Methoxy-indan-(1Z)-ylidenemethyl]-thiazole DMPDN63 Discovery agent N.A. Investigative [31]
6-((1H-imidazol-1-yl)methyl)-2H-chromene-2-thione DMOR04W Discovery agent N.A. Investigative [20]
6-Imidazol-1-yl-isoquinoline DMQXL1Y Discovery agent N.A. Investigative [20]
7,4'-Dihydroxyflavone DMXQ1K0 Discovery agent N.A. Investigative [6]
7-((1H-imidazol-1-yl)methyl)-2H-chromen-2-one DM2UTEA Discovery agent N.A. Investigative [20]
7-((1H-imidazol-1-yl)methyl)-4H-chromen-4-one DMOS4ZQ Discovery agent N.A. Investigative [20]
7-((1H-imidazol-1-yl)methyl)isoquinoline DM9ID4T Discovery agent N.A. Investigative [20]
7-(2-(1H-imidazol-1-yl)ethoxy)-2H-chromen-2-one DM4HUO1 Discovery agent N.A. Investigative [40]
7-hydroxy-2-(3-hydroxyphenyl)chroman-4-one DMXBUNV Discovery agent N.A. Investigative [17]
7-hydroxy-2-phenylchroman-4-one DM4UW65 Discovery agent N.A. Investigative [17]
7-[1,2,4]Triazol-4-ylmethyl-chromen-4-one DMNGLM1 Discovery agent N.A. Investigative [26]
8-Imidazol-1-ylmethyl-5-nitro-chromen-4-one DMA26L4 Discovery agent N.A. Investigative [26]
9-Hydroxy-7,8-benzoflavone DMH72MU Discovery agent N.A. Investigative [6]
ALBANOL A DMHIW2L Discovery agent N.A. Investigative [18]
ALPHA-NAPHTHOFLAVONE DMELOIQ Discovery agent N.A. Investigative [6]
ANDROSTENEDONE DMPL0BA Discovery agent N.A. Investigative [41]
APIGENIN DMI3491 Discovery agent N.A. Investigative [6]
Benzyl-biphenyl-4-ylmethyl-imidazol-1-yl-amine DMFB4M5 Discovery agent N.A. Investigative [19]
biochanin A DM0HPWY Discovery agent N.A. Investigative [6]
Broussoflavonol F DMB9SEI Discovery agent N.A. Investigative [18]
CGS-18320B DM2CS5A Discovery agent N.A. Investigative [6]
Chrysin DM7V2LG Discovery agent N.A. Investigative [6]
DEHYDROLEUCODIN DM0V1NH Discovery agent N.A. Investigative [6]
Docosapentaenoic acid DMVCP6X Discovery agent N.A. Investigative [42]
flavone DMEQH6J Discovery agent N.A. Investigative [6]
Gamma-mangostin DMC0OVP Discovery agent N.A. Investigative [43]
GARCINONE D DMQDV3U Discovery agent N.A. Investigative [43]
GOSSYPETIN DMMT05U Discovery agent N.A. Investigative [44]
Isogemichalcone C DM31AXO Discovery agent N.A. Investigative [18]
ISOLICOFLAVONOL DMYEGBC Discovery agent N.A. Investigative [18]
LIQUIRTIGENIN DM6YSG3 Discovery agent N.A. Investigative [44]
LUDARTIN DMI9VNO Discovery agent N.A. Investigative [6]
MDL-18962 DMTVOWC Discovery agent N.A. Investigative [45]
MONODICTYOCHROMONE B DM59CR0 Discovery agent N.A. Investigative [46]
MORACHALCONE A DMWR0J1 Discovery agent N.A. Investigative [18]
MR-16089 DMM2WG7 Discovery agent N.A. Investigative [6]
MR-20492 DMEBQLK Discovery agent N.A. Investigative [6]
MR-20494 DMC79YF Discovery agent N.A. Investigative [6]
MR-20496 DMTCG8M Discovery agent N.A. Investigative [47]
MR-20814 DMSR3OI Discovery agent N.A. Investigative [47]
N-(2-benzyloxy-4-nitrophenyl)methanesulfonamide DMW5XLG Discovery agent N.A. Investigative [48]
N-(2-hexyloxy-4-nitrophenyl)methanesulfonamide DM27L53 Discovery agent N.A. Investigative [49]
N-(2-nonyloxy-4-nitrophenyl)methanesulfonamide DMU6FPL Discovery agent N.A. Investigative [49]
N-(2-Propyloxy-4-nitrophenyl)methanesulfonamide DMAQMXJ Discovery agent N.A. Investigative [49]
N-[2-(4'-Nitrophenyl)ethyl]-imidazole DMPKBT1 Discovery agent N.A. Investigative [6]
NSC-122427 DMYMB4A Discovery agent N.A. Investigative [50]
NSC-12999 DMJAO6Z Discovery agent N.A. Investigative [20]
NSC-131736 DMYJNS9 Discovery agent N.A. Investigative [20]
NSC-289311 DMZU1L0 Discovery agent N.A. Investigative [20]
NSC-356483 DMEK5B2 Discovery agent N.A. Investigative [20]
NSC-356781 DM9LI7M Discovery agent N.A. Investigative [20]
NSC-368272 DMR97X3 Discovery agent N.A. Investigative [20]
NSC-368280 DMR3IP5 Discovery agent N.A. Investigative [20]
NSC-369087 DMAQWM8 Discovery agent N.A. Investigative [20]
NSC-613604 DMD1XM0 Discovery agent N.A. Investigative [50]
NSC-625409 DM0GWAC Discovery agent N.A. Investigative [20]
NSC-666292 DMNMF0C Discovery agent N.A. Investigative [20]
NSC-683634 DMZ2KUB Discovery agent N.A. Investigative [20]
NSC-75308 DM8GZAM Discovery agent N.A. Investigative [20]
NSC-93358 DMTOFS7 Discovery agent N.A. Investigative [50]
NSC-94258 DM6VY3P Discovery agent N.A. Investigative [6]
NSC-94891 DM31CZK Discovery agent N.A. Investigative [50]
Org-33201 DMDY38R Discovery agent N.A. Investigative [51]
------------------------------------------------------------------------------------
⏷ Show the Full List of 220 Investigative Drug(s)

The Drug-Metabolizing Enzyme (DME) Role of This DTT

DTT DME Name Aromatase (CYP19A1) DME Info
Gene Name CYP19A1
7 Approved Drug(s) Metabolized by This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Letrozole DMH07Y3 Estrogen-receptor positive breast cancer Approved [52]
Levomethadyl acetate hydrochloride DM429AE N. A. N. A. Approved [53]
Methadone DMTW6IU Advanced cancer 2A00-2F9Z Approved [54]
Nandrolone DMFWKG1 Osteoporosis FB83.0 Approved [55]
Prasterone DM67VKL Chronic obstructive pulmonary disease CA22 Approved [56]
Testosterone cypionate DMC1TEV N. A. N. A. Approved [57]
Dihydrotestosterone DM3S8XC Prostate hyperplasia GA90 Phase 4 [58]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Approved Drug(s)

References

1 Aminoglutethimide-induced protein free radical formation on myeloperoxidase: a potential mechanism of agranulocytosis. Chem Res Toxicol. 2007 Jul;20(7):1038-45.
2 Effective aromatase inhibition by anastrozole in a patient with gonadotropin-independent precocious puberty in McCune-Albright syndrome. J Pediatr Endocrinol Metab. 2002;15 Suppl 3:945-8.
3 Aromatase inhibitors--theoretical concept and present experiences in the treatment of endometriosis. Zentralbl Gynakol. 2003 Jul-Aug;125(7-8):247-51.
4 Enantioselective nonsteroidal aromatase inhibitors identified through a multidisciplinary medicinal chemistry approach. J Med Chem. 2005 Nov 17;48(23):7282-9.
5 Aromatase inhibitors for male infertility. J Urol. 2002 Feb;167(2 Pt 1):624-9.
6 Pharmacophore modeling strategies for the development of novel nonsteroidal inhibitors of human aromatase (CYP19). Bioorg Med Chem Lett. 2010 May 15;20(10):3050-64.
7 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032111)
8 Highly potent first examples of dual aromatase-steroid sulfatase inhibitors based on a biphenyl template. J Med Chem. 2010 Mar 11;53(5):2155-70.
9 The taiwaniaquinoids: a review. J Nat Prod. 2010 Feb 26;73(2):284-98.
10 Pharmacokinetics of finrozole (MPV-2213ad), a novel selective aromatase inhibitor, in healthy men. Br J Clin Pharmacol. 2001 Dec;52(6):702-4.
11 Effects of aromatase inhibitors on the pathobiology of the human breast, endometrial and ovarian carcinoma. Endocr Relat Cancer. 1999 Jun;6(2):197-204.
12 Chiral aromatase and dual aromatase-steroid sulfatase inhibitors from the letrozole template: synthesis, absolute configuration, and in vitro activ... J Med Chem. 2008 Jul 24;51(14):4226-38.
13 First dual aromatase-steroid sulfatase inhibitors. J Med Chem. 2003 Jul 17;46(15):3193-6.
14 High-performance liquid chromatographic determination of FCE 24928, a new aromatase inhibitor, in human plasma. J Chromatogr A. 1994 Feb 4;660(1-2):293-8.
15 Analogues of 3-ethyl-3-(4-pyridyl)piperidine-2,6-dione as selective inhibitors of aromatase: derivatives with variable 1-alkyl and 3-alkyl substitu... J Med Chem. 1987 Sep;30(9):1550-4.
16 Synthesis and biological evaluation of (+/-)-abyssinone II and its analogues as aromatase inhibitors for chemoprevention of breast cancer. J Med Chem. 2007 Jun 14;50(12):2799-806.
17 New 7,8-benzoflavanones as potent aromatase inhibitors: synthesis and biological evaluation. Bioorg Med Chem. 2008 Feb 1;16(3):1474-80.
18 Aromatase inhibitors from Broussonetia papyrifera. J Nat Prod. 2001 Oct;64(10):1286-93.
19 CYP19 (aromatase): exploring the scaffold flexibility for novel selective inhibitors. Bioorg Med Chem. 2008 Sep 15;16(18):8349-58.
20 Fast three dimensional pharmacophore virtual screening of new potent non-steroid aromatase inhibitors. J Med Chem. 2009 Jan 8;52(1):143-50.
21 Novel highly potent and selective nonsteroidal aromatase inhibitors: synthesis, biological evaluation and structure-activity relationships investigation. J Med Chem. 2010 Jul 22;53(14):5347-51.
22 Heteroaryl-substituted naphthalenes and structurally modified derivatives: selective inhibitors of CYP11B2 for the treatment of congestive heart fa... J Med Chem. 2005 Oct 20;48(21):6632-42.
23 Design, synthesis, and biological evaluation of resveratrol analogues as aromatase and quinone reductase 2 inhibitors for chemoprevention of cancer. Bioorg Med Chem. 2010 Jul 15;18(14):5352-66.
24 Fadrozole hydrochloride: a potent, selective, nonsteroidal inhibitor of aromatase for the treatment of estrogen-dependent disease. J Med Chem. 1991 Feb;34(2):725-36.
25 Synthesis and evaluation of 4-triazolylflavans as new aromatase inhibitors. Bioorg Med Chem Lett. 2004 Oct 18;14(20):5215-8.
26 A new class of nonsteroidal aromatase inhibitors: design and synthesis of chromone and xanthone derivatives and inhibition of the P450 enzymes aromatase and 17 alpha-hydroxylase/C17,20-lyase. J Med Chem. 2001 Mar 1;44(5):672-80.
27 New selective nonsteroidal aromatase inhibitors: synthesis and inhibitory activity of 2,3 or 5-(alpha-azolylbenzyl)-1H-indoles. Bioorg Med Chem Lett. 1999 Feb 8;9(3):333-6.
28 Synthesis and characterization of azole isoflavone inhibitors of aromatase. Bioorg Med Chem. 2005 Jun 2;13(12):4063-70.
29 New aromatase inhibitors. Synthesis and inhibitory activity of pyridinyl-substituted flavanone derivatives. Bioorg Med Chem Lett. 2002 Apr 8;12(7):1059-61.
30 Synthesis and evaluation of heteroaryl-substituted dihydronaphthalenes and indenes: potent and selective inhibitors of aldosterone synthase (CYP11B... J Med Chem. 2006 Apr 6;49(7):2222-31.
31 Synthesis and evaluation of (pyridylmethylene)tetrahydronaphthalenes/-indanes and structurally modified derivatives: potent and selective inhibitor... J Med Chem. 2005 Mar 10;48(5):1563-75.
32 Synthesis and biochemical evaluation of analogues of aminoglutethimide based on phenylpyrrolidine-2,5-dione. J Med Chem. 1986 Apr;29(4):520-3.
33 Aromatase inhibitors. Synthesis and evaluation of mammary tumor inhibiting activity of 3-alkylated 3-(4-aminophenyl)piperidine-2,6-diones. J Med Chem. 1986 Aug;29(8):1362-9.
34 In vivo active aldosterone synthase inhibitors with improved selectivity: lead optimization providing a series of pyridine substituted 3,4-dihydro-... J Med Chem. 2008 Dec 25;51(24):8077-87.
35 Lead optimization providing a series of flavone derivatives as potent nonsteroidal inhibitors of the cytochrome P450 aromatase enzyme. J Med Chem. 2006 Jul 27;49(15):4777-80.
36 Replacement of imidazolyl by pyridyl in biphenylmethylenes results in selective CYP17 and dual CYP17/CYP11B1 inhibitors for the treatment of prosta... J Med Chem. 2010 Aug 12;53(15):5749-58.
37 Aromatase inhibitors: synthesis, biological activity, and binding mode of azole-type compounds. J Med Chem. 1993 May 14;36(10):1393-400.
38 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
39 Synthesis and evaluation of imidazolylmethylenetetrahydronaphthalenes and imidazolylmethyleneindanes: potent inhibitors of aldosterone synthase. J Med Chem. 2005 Mar 24;48(6):1796-805.
40 Design, synthesis, and 3D QSAR of novel potent and selective aromatase inhibitors. J Med Chem. 2004 Dec 30;47(27):6792-803.
41 Effects of steroid D-ring modification on suicide inactivation and competitive inhibition of aromatase by analogues of androsta-1,4-diene-3,17-dione. J Med Chem. 1989 Mar;32(3):651-8.
42 Interference by naturally occurring fatty acids in a noncellular enzyme-based aromatase bioassay. J Nat Prod. 2006 Apr;69(4):700-3.
43 Xanthones from the botanical dietary supplement mangosteen (Garcinia mangostana) with aromatase inhibitory activity. J Nat Prod. 2008 Jul;71(7):1161-6.
44 Screening of herbal constituents for aromatase inhibitory activity. Bioorg Med Chem. 2008 Sep 15;16(18):8466-70.
45 6 beta-Propynyl-substituted steroids: mechanism-based enzyme-activated irreversible inhibitors of aromatase. J Med Chem. 1997 Sep 26;40(20):3263-70.
46 Monodictyochromes A and B, dimeric xanthone derivatives from the marine algicolous fungus Monodictys putredinis. J Nat Prod. 2008 Nov;71(11):1793-9.
47 Design and synthesis of a new type of non steroidal human aromatase inhibitors. Bioorg Med Chem Lett. 1998 May 5;8(9):1041-4.
48 Synthesis and biological evaluation of selective aromatase expression regulators in breast cancer cells. J Med Chem. 2007 Apr 5;50(7):1635-44.
49 Novel sulfonanilide analogues suppress aromatase expression and activity in breast cancer cells independent of COX-2 inhibition. J Med Chem. 2006 Feb 23;49(4):1413-9.
50 An efficient steroid pharmacophore-based strategy to identify new aromatase inhibitors. Eur J Med Chem. 2009 Oct;44(10):4121-7.
51 Org 33201: a new highly selective orally active aromatase inhibitor. J Steroid Biochem Mol Biol. 1993 Mar;44(4-6):681-2.
52 Double-blind, randomised, multicentre endocrine trial comparing two letrozole doses, in postmenopausal breast cancer patients. Eur J Cancer. 1999 Feb;35(2):208-13.
53 N-demethylation of levo-alpha-acetylmethadol by human placental aromatase. Biochem Pharmacol. 2004 Mar 1;67(5):885-92.
54 Bidirectional transfer of methadone across human placenta. Biochem Pharmacol. 2005 Jan 1;69(1):187-97.
55 Aromatization of testosterone and 19-nortestosterone by a single enzyme from equine testicular microsomes. Differences from human placental aromatase. J Steroid Biochem. 1988 Jan;29(1):119-25.
56 Urinary and serum octopamine in patients with portal-systemic encephalopathy. Lancet. 1975 Nov 15;2(7942):943-6.
57 Loss of aromatase cytochrome P450 function as a risk factor for Parkinson's disease? Brain Res Rev. 2008 Mar;57(2):431-43.
58 Identifying susceptibility genes for prostate cancer--a family-based association study of polymorphisms in CYP17, CYP19, CYP11A1, and LH-beta. Cancer Epidemiol Biomarkers Prev. 2005 Aug;14(8):2035-9.