Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0MYZ0F)

• DOT Name: Protein FAM163A (FAM163A)
• Synonyms: Cebelin; Neuroblastoma-derived secretory protein
• Gene Name: FAM163A
• Related Disease:
  Advanced cancer
  Neuroblastoma
  Lung squamous cell carcinoma
  Neoplasm
• UniProt ID: F163A_HUMAN
• Pfam ID: PF15069
• Sequence:
  MTAGTVVITGGILATVILLCIIAVLCYCRLQYYCCKKSGTEVADEEEEREHDLPTHPRGP
  TCNACSSQALDGRGSLAPLTSEPCSQPCGVAASHCTTCSPYSSPFYIRTADMVPNGGGGE
  RLSFAPTYYKEGGPPSLKLAAPQSYPVTWPGSGREAFTNPRAISTDV
• Tissue Specificity: Highly expressed in neuroblastoma compared to other tissues, suggesting that it may be used as a marker for metastasis in bone marrow.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[2]
Lung squamous cell carcinoma	DISXPIBD	Disputed	Biomarker	[2]
Neoplasm	DISZKGEW	Disputed	Altered Expression	[2]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Protein FAM163A (FAM163A).	[3]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Protein FAM163A (FAM163A).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein FAM163A (FAM163A).	[10]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Protein FAM163A (FAM163A).	[7]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Protein FAM163A (FAM163A).	[4]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Protein FAM163A (FAM163A).	[5]
Panobinostat	DM58WKG	Approved	Panobinostat affects the expression of Protein FAM163A (FAM163A).	[6]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Protein FAM163A (FAM163A).	[8]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Protein FAM163A (FAM163A).	[9]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 affects the expression of Protein FAM163A (FAM163A).	[6]

References

• [1] Neuroblastoma-derived secretory protein is a novel secreted factor overexpressed in neuroblastoma.Mol Cancer Ther. 2009 Aug;8(8):2478-89. doi: 10.1158/1535-7163.MCT-08-1132. Epub 2009 Aug 11.
• [2] FAM163A, a positive regulator of ERK signaling pathway, interacts with 14-3-3 and promotes cell proliferation in squamous cell lung carcinoma.Onco Targets Ther. 2019 Aug 13;12:6393-6406. doi: 10.2147/OTT.S214731. eCollection 2019.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [5] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [6] The Bromodomain Inhibitor JQ1 and the Histone Deacetylase Inhibitor Panobinostat Synergistically Reduce N-Myc Expression and Induce Anticancer Effects. Clin Cancer Res. 2016 May 15;22(10):2534-44. doi: 10.1158/1078-0432.CCR-15-1666. Epub 2016 Jan 5.
• [7] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [8] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [9] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.