Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1V4WQF)

DOT Name CD83 antigen (CD83)
Synonyms hCD83; B-cell activation protein; Cell surface protein HB15; CD antigen CD83
Gene Name CD83
UniProt ID
CD83_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
5MIX; 5MJ0; 5MJ1; 5MJ2
Pfam ID
PF07686
Sequence
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERM
ETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSG
KVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGM
ERAFLPVTSPNKHLGLVTPHKTELV
Function May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.
Tissue Specificity Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
39 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of CD83 antigen (CD83). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of CD83 antigen (CD83). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of CD83 antigen (CD83). [3]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of CD83 antigen (CD83). [4]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of CD83 antigen (CD83). [5]
Estradiol DMUNTE3 Approved Estradiol increases the expression of CD83 antigen (CD83). [6]
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of CD83 antigen (CD83). [7]
Quercetin DM3NC4M Approved Quercetin increases the expression of CD83 antigen (CD83). [8]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of CD83 antigen (CD83). [9]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of CD83 antigen (CD83). [10]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of CD83 antigen (CD83). [11]
Marinol DM70IK5 Approved Marinol decreases the expression of CD83 antigen (CD83). [12]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of CD83 antigen (CD83). [13]
Progesterone DMUY35B Approved Progesterone decreases the expression of CD83 antigen (CD83). [14]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of CD83 antigen (CD83). [15]
Troglitazone DM3VFPD Approved Troglitazone increases the expression of CD83 antigen (CD83). [16]
Simvastatin DM30SGU Approved Simvastatin decreases the expression of CD83 antigen (CD83). [17]
Alitretinoin DMME8LH Approved Alitretinoin increases the expression of CD83 antigen (CD83). [18]
Exemestane DM9HPW3 Approved Exemestane increases the expression of CD83 antigen (CD83). [19]
Betamethasone valerate DMMIAXO Approved Betamethasone valerate decreases the expression of CD83 antigen (CD83). [20]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of CD83 antigen (CD83). [19]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of CD83 antigen (CD83). [21]
Atorvastatin DMF28YC Phase 3 Trial Atorvastatin decreases the expression of CD83 antigen (CD83). [17]
I3C DMIGFOR Phase 3 I3C decreases the expression of CD83 antigen (CD83). [22]
DNCB DMDTVYC Phase 2 DNCB increases the expression of CD83 antigen (CD83). [23]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of CD83 antigen (CD83). [24]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of CD83 antigen (CD83). [25]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of CD83 antigen (CD83). [26]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of CD83 antigen (CD83). [27]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of CD83 antigen (CD83). [29]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of CD83 antigen (CD83). [15]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of CD83 antigen (CD83). [30]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of CD83 antigen (CD83). [31]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of CD83 antigen (CD83). [32]
Resorcinol DMM37C0 Investigative Resorcinol increases the expression of CD83 antigen (CD83). [33]
cinnamaldehyde DMZDUXG Investigative cinnamaldehyde increases the expression of CD83 antigen (CD83). [34]
Chlorpyrifos DMKPUI6 Investigative Chlorpyrifos decreases the expression of CD83 antigen (CD83). [35]
Beta-D-Glucose DM5IHYP Investigative Beta-D-Glucose increases the expression of CD83 antigen (CD83). [36]
muramyl dipeptide DM4FR71 Investigative muramyl dipeptide increases the expression of CD83 antigen (CD83). [37]
------------------------------------------------------------------------------------
⏷ Show the Full List of 39 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of CD83 antigen (CD83). [28]
------------------------------------------------------------------------------------

References

1 The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
6 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
7 Gene expression profiles in peripheral lymphocytes by arsenic exposure and skin lesion status in a Bangladeshi population. Cancer Epidemiol Biomarkers Prev. 2006 Jul;15(7):1367-75. doi: 10.1158/1055-9965.EPI-06-0106.
8 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
9 Vitamin D Counteracts an IL-23-Dependent IL-17A(+)IFN-(+) Response Driven by Urban Particulate Matter. Am J Respir Cell Mol Biol. 2017 Sep;57(3):355-366. doi: 10.1165/rcmb.2016-0409OC.
10 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
11 Peripheral blood expression of nuclear factor-kappab-regulated genes is associated with rheumatoid arthritis disease activity and responds differentially to anti-tumor necrosis factor-alpha versus methotrexate. J Rheumatol. 2007 Sep;34(9):1817-22. Epub 2007 Aug 1.
12 Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
13 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
14 Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
15 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
16 Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
17 Differential effects of statins on relevant functions of human monocyte-derived dendritic cells. J Leukoc Biol. 2006 Mar;79(3):529-38. doi: 10.1189/jlb.0205064. Epub 2005 Dec 30.
18 9-cis-Retinoic acid (9cRA), a retinoid X receptor (RXR) ligand, exerts immunosuppressive effects on dendritic cells by RXR-dependent activation: inhibition of peroxisome proliferator-activated receptor gamma blocks some of the 9cRA activities, and precludes them to mature phenotype development. J Immunol. 2007 May 15;178(10):6130-9. doi: 10.4049/jimmunol.178.10.6130.
19 Effects of aromatase inhibitors on human osteoblast and osteoblast-like cells: a possible androgenic bone protective effects induced by exemestane. Bone. 2007 Apr;40(4):876-87. doi: 10.1016/j.bone.2006.11.029. Epub 2006 Dec 28.
20 Pimecrolimus leads to an apoptosis-induced depletion of T cells but not Langerhans cells in patients with atopic dermatitis. J Allergy Clin Immunol. 2005 Jun;115(6):1276-83. doi: 10.1016/j.jaci.2005.02.011.
21 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
22 Aryl hydrocarbon receptor signaling modifies Toll-like receptor-regulated responses in human dendritic cells. Arch Toxicol. 2017 May;91(5):2209-2221.
23 Characterization of reconstructed human skin containing Langerhans cells to monitor molecular events in skin sensitization. Toxicol In Vitro. 2018 Feb;46:77-85. doi: 10.1016/j.tiv.2017.09.019. Epub 2017 Sep 21.
24 Expression of endogenous retroviruses reflects increased usage of atypical enhancers in T cells. EMBO J. 2019 Jun 17;38(12):e101107. doi: 10.15252/embj.2018101107. Epub 2019 May 8.
25 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
26 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
27 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
28 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
29 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
30 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
31 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
32 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
33 Technical advance: Langerhans cells derived from a human cell line in a full-thickness skin equivalent undergo allergen-induced maturation and migration. J Leukoc Biol. 2011 Nov;90(5):1027-33. doi: 10.1189/jlb.0610374. Epub 2011 Jun 22.
34 MUTZ-3 Langerhans cell maturation and CXCL12 independent migration in reconstructed human gingiva. ALTEX. 2016;33(4):423-434. doi: 10.14573/altex.1510301. Epub 2016 May 19.
35 Influence of organophosphate poisoning on human dendritic cells. Chem Biol Interact. 2013 Dec 5;206(3):472-8. doi: 10.1016/j.cbi.2013.08.011. Epub 2013 Aug 29.
36 Expression and function of mixed lineage kinases in dendritic cells. Int Immunol. 2007 Aug;19(8):923-33. doi: 10.1093/intimm/dxm050. Epub 2007 Aug 13.
37 Synergistic effect of Nod1 and Nod2 agonists with toll-like receptor agonists on human dendritic cells to generate interleukin-12 and T helper type 1 cells. Infect Immun. 2005 Dec;73(12):7967-76. doi: 10.1128/IAI.73.12.7967-7976.2005.