Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT29LW7B)

DOT Name Uncharacterized protein C8orf88 (C8ORF88)
Gene Name C8ORF88
UniProt ID
CH088_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCKTNGMQAFSQ
GLNEQQQQQSPVKKERIKYSRDFLLKLSSVSICRKKPDFLPDHPIVLQKPENNQSFK

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Uncharacterized protein C8orf88 (C8ORF88). [1]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Uncharacterized protein C8orf88 (C8ORF88). [2]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Uncharacterized protein C8orf88 (C8ORF88). [3]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Uncharacterized protein C8orf88 (C8ORF88). [1]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Uncharacterized protein C8orf88 (C8ORF88). [1]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Uncharacterized protein C8orf88 (C8ORF88). [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
2 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
3 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.