Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2BZTSU)

DOT Name EMILIN-3 (EMILIN3)
Synonyms EMILIN-5; Elastin microfibril interface-located protein 3; Elastin microfibril interfacer 3; Elastin microfibril interface-located protein 5; Elastin microfibril interfacer 5
Gene Name EMILIN3
Related Disease
Neoplasm ( )
Neoplasm of esophagus ( )
UniProt ID
EMIL3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF07546
Sequence
MGRRRLLVWLCAVAALLSGAQARGTPLLARPAPPGASRYSLYTTGWRPRLRPGPHKALCA
YVVHRNVTCILQEGAESYVKAEYRQCRWGPKCPGTVTYRTVLRPKYKVGYKTVTDLAWRC
CPGFTGKRCPEHLTDHGAASPQLEPEPQIPSGQLDPGPRPPSYSRAAPSPHGRKGPGLFG
ERLERLEGDVQRLAQTYGTLSGLVASHEDPNRMTGGPRAPAVPVGFGVIPEGLVGPGDRA
RGPLTPPLDEILSKVTEVSNTLQTKVQLLDKVHGLALGHEAHLQRLREAPPSPLTSLALL
EEYVDRRLHRLWGSLLDGFEQKLQGVQSECDLRVQEVRRQCEEGQAASRRLHQSLDGREL
ALRQELSQLGSQLQGLSVSGRGSCCGQLALINARMDGLERALQAVTETQRGPGAPAGDEL
TRLSAAMLEGGVDGLLEGLETLNGTEGGARGCCLRLDMGGWGVGGFGTMLEERVQSLEER
LATLAGELSHDSASPGRSARPLVQTELAVLEQRLVSLETSCTPSTTSAILDSLVAEVKAW
QSRSEALLRQVASHAALLQQLNGTVAEVQGQLAEGTGSSLQGEITLLKVNLNSVSKSLTG
LSDSVSQYSDAFLAANTSLDERERKVEAEVQAIQEQVSSQGSRLQAGHRQVLNLRGELEQ
LKAGVAKVASGLSRCQDTAQKLQHTVGHFDQRVAQVEGACRRLGLLAAGLDSLPTEPLRP
REGLWSHVDQLNRTLAQHTQDIARLRDDLLDCQAQLAEQVRPGQAN
Reactome Pathway
Molecules associated with elastic fibres (R-HSA-2129379 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Neoplasm DISZKGEW Strong Biomarker [1]
Neoplasm of esophagus DISOLKAQ Limited Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of EMILIN-3 (EMILIN3). [3]
------------------------------------------------------------------------------------
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of EMILIN-3 (EMILIN3). [4]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of EMILIN-3 (EMILIN3). [5]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of EMILIN-3 (EMILIN3). [6]
Panobinostat DM58WKG Approved Panobinostat decreases the expression of EMILIN-3 (EMILIN3). [7]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of EMILIN-3 (EMILIN3). [8]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of EMILIN-3 (EMILIN3). [9]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of EMILIN-3 (EMILIN3). [10]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of EMILIN-3 (EMILIN3). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Integrative Analysis of DNA Methylation and Gene Expression Identify a Three-Gene Signature for Predicting Prognosis in Lower-Grade Gliomas.Cell Physiol Biochem. 2018;47(1):428-439. doi: 10.1159/000489954. Epub 2018 May 18.
2 Preparation and characterization of a novel monoclonal antibody specific to human EMILIN-5 protein.Hybridoma (Larchmt). 2007 Dec;26(6):417-21. doi: 10.1089/hyb.2007.0528.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
5 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
6 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
7 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
8 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
9 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
10 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
11 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.