Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2JYBZ6)

• DOT Name: Transcription elongation factor A protein-like 2 (TCEAL2)
• Synonyms: TCEA-like protein 2; Transcription elongation factor S-II protein-like 2
• Gene Name: TCEAL2
• UniProt ID: TCAL2_HUMAN
• Pfam ID: PF04538
• Sequence:
  MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKKLENEGNTENTGKRVEEPLKD
  KEKPESAGKAKGEGKSERKGKSEMQGGSKTEGKPERGGRAEGEGEPDSEREPESEGEPES
  ETRAAGKRPAEDDIPRKAKRKTNKGLAQYLKQYKEAIHDMNFSNEDMIREFDNMARVEDK
  RRKSKQKLGAFLWMQRNLQDPFYPRGPREFRGGCRAPRRDTEDIPYV
• Function: May be involved in transcriptional regulation.

Molecular Interaction Atlas (MIA) of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Transcription elongation factor A protein-like 2 (TCEAL2).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Transcription elongation factor A protein-like 2 (TCEAL2).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Transcription elongation factor A protein-like 2 (TCEAL2).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Transcription elongation factor A protein-like 2 (TCEAL2).	[4]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Transcription elongation factor A protein-like 2 (TCEAL2).	[6]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Transcription elongation factor A protein-like 2 (TCEAL2).	[4]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Transcription elongation factor A protein-like 2 (TCEAL2).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Transcription elongation factor A protein-like 2 (TCEAL2).	[9]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Transcription elongation factor A protein-like 2 (TCEAL2).	[10]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Transcription elongation factor A protein-like 2 (TCEAL2).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Transcription elongation factor A protein-like 2 (TCEAL2).	[8]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [5] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [6] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [7] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [10] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.