General Information of Drug Off-Target (DOT) (ID: OT2LQ771)

DOT Name Tripeptidyl-peptidase 1 (TPP1)
Synonyms TPP-1; EC 3.4.14.9; Cell growth-inhibiting gene 1 protein; Lysosomal pepstatin-insensitive protease; LPIC; Tripeptidyl aminopeptidase; Tripeptidyl-peptidase I; TPP-I
Gene Name TPP1
Related Disease
Neuronal ceroid lipofuscinosis ( )
Neuronal ceroid lipofuscinosis 2 ( )
Autosomal recessive spinocerebellar ataxia 7 ( )
UniProt ID
TPP1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3EDY; 3EE6
EC Number
3.4.14.9
Pfam ID
PF00082 ; PF09286
Sequence
MGLQACLLGLFALILSGKCSYSPEPDQRRTLPPGWVSLGRADPEEELSLTFALRQQNVER
LSELVQAVSDPSSPQYGKYLTLENVADLVRPSPLTLHTVQKWLLAAGAQKCHSVITQDFL
TCWLSIRQAELLLPGAEFHHYVGGPTETHVVRSPHPYQLPQALAPHVDFVGGLHRFPPTS
SLRQRPEPQVTGTVGLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDL
AQFMRLFGGNFAHQASVARVVGQQGRGRAGIEASLDVQYLMSAGANISTWVYSSPGRHEG
QEPFLQWLMLLSNESALPHVHTVSYGDDEDSLSSAYIQRVNTELMKAAARGLTLLFASGD
SGAGCWSVSGRHQFRPTFPASSPYVTTVGGTSFQEPFLITNEIVDYISGGGFSNVFPRPS
YQEEAVTKFLSSSPHLPPSSYFNASGRAYPDVAALSDGYWVVSNRVPIPWVSGTSASTPV
FGGILSLINEHRILSGRPPLGFLNPRLYQQHGAGLFDVTRGCHESCLDEEVEGQGFCSGP
GWDPVTGWGTPNFPALLKTLLNP
Function
Lysosomal serine protease with tripeptidyl-peptidase I activity. May act as a non-specific lysosomal peptidase which generates tripeptides from the breakdown products produced by lysosomal proteinases. Requires substrates with an unsubstituted N-terminus.
Tissue Specificity Detected in all tissues examined with highest levels in heart and placenta and relatively similar levels in other tissues.
KEGG Pathway
Lysosome (hsa04142 )
Reactome Pathway
XBP1(S) activates chaperone genes (R-HSA-381038 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Neuronal ceroid lipofuscinosis DIS9A4K4 Definitive Autosomal recessive [1]
Neuronal ceroid lipofuscinosis 2 DISKPI4X Definitive Autosomal recessive [1]
Autosomal recessive spinocerebellar ataxia 7 DIS8JTK7 Supportive Autosomal recessive [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Tripeptidyl-peptidase 1 (TPP1). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Tripeptidyl-peptidase 1 (TPP1). [17]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Tripeptidyl-peptidase 1 (TPP1). [19]
------------------------------------------------------------------------------------
19 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Tripeptidyl-peptidase 1 (TPP1). [4]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Tripeptidyl-peptidase 1 (TPP1). [5]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of Tripeptidyl-peptidase 1 (TPP1). [6]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Tripeptidyl-peptidase 1 (TPP1). [7]
Quercetin DM3NC4M Approved Quercetin increases the expression of Tripeptidyl-peptidase 1 (TPP1). [8]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Tripeptidyl-peptidase 1 (TPP1). [9]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of Tripeptidyl-peptidase 1 (TPP1). [10]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Tripeptidyl-peptidase 1 (TPP1). [11]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Tripeptidyl-peptidase 1 (TPP1). [6]
Selenium DM25CGV Approved Selenium increases the expression of Tripeptidyl-peptidase 1 (TPP1). [12]
Fluorouracil DMUM7HZ Approved Fluorouracil affects the expression of Tripeptidyl-peptidase 1 (TPP1). [13]
Gentamicin DMKINJO Approved Gentamicin increases the expression of Tripeptidyl-peptidase 1 (TPP1). [14]
LY2835219 DM93VBZ Approved LY2835219 increases the expression of Tripeptidyl-peptidase 1 (TPP1). [15]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of Tripeptidyl-peptidase 1 (TPP1). [12]
GSK2110183 DMZHB37 Phase 2 GSK2110183 increases the expression of Tripeptidyl-peptidase 1 (TPP1). [16]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Tripeptidyl-peptidase 1 (TPP1). [18]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Tripeptidyl-peptidase 1 (TPP1). [20]
Bilirubin DMI0V4O Investigative Bilirubin decreases the expression of Tripeptidyl-peptidase 1 (TPP1). [21]
PP-242 DM2348V Investigative PP-242 increases the expression of Tripeptidyl-peptidase 1 (TPP1). [22]
------------------------------------------------------------------------------------
⏷ Show the Full List of 19 Drug(s)

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Autosomal recessive spinocerebellar ataxia 7 (SCAR7) is caused by variants in TPP1, the gene involved in classic late-infantile neuronal ceroid lipofuscinosis 2 disease (CLN2 disease). Hum Mutat. 2013 May;34(5):706-13. doi: 10.1002/humu.22292. Epub 2013 Mar 11.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
5 Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
6 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
7 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
8 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
9 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
10 Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
11 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
12 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
13 Multi-level gene expression profiles affected by thymidylate synthase and 5-fluorouracil in colon cancer. BMC Genomics. 2006 Apr 3;7:68. doi: 10.1186/1471-2164-7-68.
14 Aminoglycoside-mediated suppression of nonsense mutations in late infantile neuronal ceroid lipofuscinosis. Eur J Paediatr Neurol. 2001;5 Suppl A:57-62. doi: 10.1053/ejpn.2000.0436.
15 Biological specificity of CDK4/6 inhibitors: dose response relationship, in vivo signaling, and composite response signature. Oncotarget. 2017 Jul 4;8(27):43678-43691. doi: 10.18632/oncotarget.18435.
16 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
17 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
18 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
19 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
20 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
21 Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
22 Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.