Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT303JGE)

DOT Name Suppressyn (ERVH48-1)
Synonyms Endogenous retrovirus group 48 member 1; NDUFV3 antisense RNA 1; endogenous retrovirus group Fb member 1
Gene Name ERVH48-1
Related Disease
Lung squamous cell carcinoma ( )
Hypertension, pregnancy-induced ( )
UniProt ID
SUPYN_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MACIYPTTFYTSLPTKSLNMGISLTTILILSVAVLLSTAAPPSCRECYQSLHYRGEMQQY
FTYHTHIERSCYGNLIEECVESGKSYYKVKNLGVCGSRNGAICPRGKQWLCFTKIGQWGV
NTQVLEDIKREQIIAKAKASKPTTPPENRPRHFHSFIQKL
Function
May play a role in trophoblasts syncytialization, the spontaneous fusion of their plasma membranes, an essential process in placental development. May negatively regulate cell-cell fusion by interacting with SLC1A5, the probable receptor on the cell surface of the fusogenic syncytin-1/ERVW-1.
Tissue Specificity Specifically expressed in placenta by extravillous trophoblasts and syncytiotrophoblasts (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Lung squamous cell carcinoma DISXPIBD Strong Biomarker [1]
Hypertension, pregnancy-induced DISHNU25 Limited Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Suppressyn (ERVH48-1). [3]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Suppressyn (ERVH48-1). [4]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Suppressyn (ERVH48-1). [5]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Suppressyn (ERVH48-1). [5]
Belinostat DM6OC53 Phase 2 Belinostat increases the expression of Suppressyn (ERVH48-1). [5]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Suppressyn (ERVH48-1). [6]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Suppressyn (ERVH48-1). [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Identification of lncRNAs associated with lung squamous cell carcinoma prognosis in the competitive endogenous RNA network.PeerJ. 2019 Sep 17;7:e7727. doi: 10.7717/peerj.7727. eCollection 2019.
2 Cellular localization of placenta-specific human endogenous retrovirus (HERV) transcripts and their possible implication in pregnancy-induced hypertension.Placenta. 2008 Mar;29(3):282-9. doi: 10.1016/j.placenta.2007.11.009. Epub 2007 Dec 26.
3 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
4 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
6 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.