General Information of Drug Off-Target (DOT) (ID: OT3A21CM)

DOT Name SHC SH2 domain-binding protein 1 (SHCBP1)
Gene Name SHCBP1
UniProt ID
SHCBP_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13229
Sequence
MADGSLTGGGLEAAAMAPERMGWAVEQELASLEKGLFQDEDSCSDCSYRDKPGSSLQSFM
PEGKTFFPEIFQTNQLLFYERFRAYQDYILADCKASEVQEFTAEFLEKVLEPSGWRAVWH
TNVFKVLVEITDVDFAALKAVVRLAEPYLCDSQVSTFTMECMKELLDLKEHRLPLQELWV
VFDDSGVFDQTALAIEHVRFFYQNIWRSWDEEEEDEYDYFVRCVEPRLRLHYDILEDRVP
SGLIVDYHNLLSQCEESYRKFLNLRSSLSNCNSDSEQENISMVEGLKLYSEMEQLKQKLK
LIENPLLRYVFGYQKNSNIQAKGVRSSGQKITHVVSSTMMAGLLRSLLTDRLCQEPGEEE
REIQFHSDPLSAINACFEGDTVIVCPGHYVVHGTFSIADSIELEGYGLPDDIVIEKRGKG
DTFVDCTGADIKISGIKFVQHDAVEGILIVHRGKTTLENCVLQCETTGVTVRTSAEFLMK
NSDLYGAKGAGIEIYPGSQCTLSDNGIHHCKEGILIKDFLDEHYDIPKISMVNNIIHNNE
GYGVVLVKPTIFSDLQENAEDGTEENKALKIQTSGEPDVAERVDLEELIECATGKMELCA
RTDPSEQVEGNCEIVNELIAASTQKGQIKKKRLSELGITQADDNLMSQEMFVGIVGNQFK
WNGKGSFGTFLF
Function
May play a role in signaling pathways governing cellular proliferation, cell growth and differentiation. May be a component of a novel signaling pathway downstream of Shc. Acts as a positive regulator of FGF signaling in neural progenitor cells.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
27 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [5]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [6]
Estradiol DMUNTE3 Approved Estradiol increases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [7]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [8]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [9]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [10]
Testosterone DM7HUNW Approved Testosterone decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [10]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [11]
Progesterone DMUY35B Approved Progesterone decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [12]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [13]
Piroxicam DMTK234 Approved Piroxicam increases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [14]
Dasatinib DMJV2EK Approved Dasatinib decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [15]
Lucanthone DMZLBUO Approved Lucanthone decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [16]
Methamphetamine DMPM4SK Approved Methamphetamine decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [17]
GSK2110183 DMZHB37 Phase 2 GSK2110183 decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [18]
PEITC DMOMN31 Phase 2 PEITC decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [19]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [20]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [21]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [22]
Coumestrol DM40TBU Investigative Coumestrol increases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [24]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [25]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate decreases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [26]
KOJIC ACID DMP84CS Investigative KOJIC ACID increases the expression of SHC SH2 domain-binding protein 1 (SHCBP1). [27]
------------------------------------------------------------------------------------
⏷ Show the Full List of 27 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of SHC SH2 domain-binding protein 1 (SHCBP1). [23]
------------------------------------------------------------------------------------

References

1 Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
2 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
7 Global gene expression profiles induced by phytoestrogens in human breast cancer cells. Endocr Relat Cancer. 2008 Mar;15(1):161-73.
8 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
9 Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
10 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
11 Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
12 Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
13 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
14 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
15 Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
16 Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
17 Methamphetamine alters the normal progression by inducing cell cycle arrest in astrocytes. PLoS One. 2014 Oct 7;9(10):e109603.
18 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
19 Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
20 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
21 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
22 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
23 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
24 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
25 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
26 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
27 Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.