General Information of Drug Off-Target (DOT) (ID: OT3IKRL2)

DOT Name Cleavage stimulation factor subunit 2 tau variant (CSTF2T)
Synonyms CF-1 64 kDa subunit tau variant; Cleavage stimulation factor 64 kDa subunit tau variant; CSTF 64 kDa subunit tau variant; TauCstF-64
Gene Name CSTF2T
Related Disease
Male infertility ( )
UniProt ID
CSTFT_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF14327 ; PF14304 ; PF00076
Sequence
MSSLAVRDPAMDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYG
FCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGPAAPIIDSPYGDPID
PEDAPESITRAVASLPPEQMFELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQAQVVMR
IMDPEIALKILHRKIHVTPLIPGKSQSVSVSGPGPGPGPGLCPGPNVLLNQQNPPAPQPQ
HLARRPVKDIPPLMQTPIQGGIPAPGPIPAAVPGAGPGSLTPGGAMQPQLGMPGVGPVPL
ERGQVQMSDPRAPIPRGPVTPGGLPPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPPHQ
GPPMHHASGHDTRGPSSHEMRGGPLGDPRLLIGEPRGPMIDQRGLPMDGRGGRDSRAMET
RAMETEVLETRVMERRGMETCAMETRGMEARGMDARGLEMRGPVPSSRGPMTGGIQGPGP
INIGAGGPPQGPRQVPGISGVGNPGAGMQGTGIQGTGMQGAGIQGGGMQGAGIQGVSIQG
GGIQGGGIQGASKQGGSQPSSFSPGQSQVTPQDQEKAALIMQVLQLTADQIAMLPPEQRQ
SILILKEQIQKSTGAS
Function May play a significant role in AAUAAA-independent mRNA polyadenylation in germ cells. Directly involved in the binding to pre-mRNAs.
KEGG Pathway
mR. surveillance pathway (hsa03015 )
Reactome Pathway
Processing of Capped Intron-Containing Pre-mRNA (R-HSA-72203 )
RNA Polymerase II Transcription Termination (R-HSA-73856 )
Processing of Intronless Pre-mRNAs (R-HSA-77595 )
mRNA 3'-end processing (R-HSA-72187 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Male infertility DISY3YZZ Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Topotecan DMP6G8T Approved Cleavage stimulation factor subunit 2 tau variant (CSTF2T) affects the response to substance of Topotecan. [14]
------------------------------------------------------------------------------------
12 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Cleavage stimulation factor subunit 2 tau variant (CSTF2T). [2]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Cleavage stimulation factor subunit 2 tau variant (CSTF2T). [3]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Cleavage stimulation factor subunit 2 tau variant (CSTF2T). [4]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Cleavage stimulation factor subunit 2 tau variant (CSTF2T). [5]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Cleavage stimulation factor subunit 2 tau variant (CSTF2T). [6]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Cleavage stimulation factor subunit 2 tau variant (CSTF2T). [7]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Cleavage stimulation factor subunit 2 tau variant (CSTF2T). [8]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Cleavage stimulation factor subunit 2 tau variant (CSTF2T). [9]
Cholecalciferol DMGU74E Approved Cholecalciferol affects the expression of Cleavage stimulation factor subunit 2 tau variant (CSTF2T). [10]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Cleavage stimulation factor subunit 2 tau variant (CSTF2T). [11]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Cleavage stimulation factor subunit 2 tau variant (CSTF2T). [12]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Cleavage stimulation factor subunit 2 tau variant (CSTF2T). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Drug(s)

References

1 Cstf2t Regulates expression of histones and histone-like proteins in male germ cells.Andrology. 2018 Jul;6(4):605-615. doi: 10.1111/andr.12488. Epub 2018 Apr 19.
2 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
4 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
5 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
6 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
9 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
10 Targeting iron homeostasis induces cellular differentiation and synergizes with differentiating agents in acute myeloid leukemia. J Exp Med. 2010 Apr 12;207(4):731-50. doi: 10.1084/jem.20091488. Epub 2010 Apr 5.
11 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
12 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
13 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
14 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.